KEGG   Cyanobacterium sp. HL-69: AA637_02290Help
Entry
AA637_02290       CDS       T05309                                 

Gene name
sod2
Definition
(GenBank) Fe-Mn family superoxide dismutase Sod2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cyl  Cyanobacterium sp. HL-69
Brite
Enzymes [BR:cyl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AA637_02290 (sod2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AUC60054
UniProt: A0A2K8WLS8
LinkDB All DBs
Position
complement(484649..485248)
Genome map
AA seq 199 aa AA seqDB search
MAYELAPLPYDYSALEPCISKSTLEFHHDKHHAAYVSKYNDAVKGTELESKSIEEVIKNI
ANDASKAGVFNNAAQAWNHSFYWQCMKPNGGGTPTGELAAKIDADFGSFDKFVEAFKAAG
ATQFGSGWAWLVLDNGTLKVTKTGNADNPITAGQTPLLTMDVWEHAYYLDYQNKRPAYID
DFLGKLVNWDFVAQNLADA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgaattagcacctcttccttacgactacagtgccttagagccttgtatctct
aaaagcaccctagaatttcaccatgacaaacatcatgccgcttatgtaagtaagtacaat
gatgcagtcaaaggtaccgaattagaatctaaatccatcgaagaagtaatcaaaaacatt
gctaatgacgctagtaaagccggtgtattcaacaatgctgcccaagcatggaatcatagc
ttctactggcaatgtatgaagcccaacggtggtggtactcccactggagaattagcagct
aaaattgacgctgactttggtagtttcgacaaatttgtagaagcattcaaagcagcaggt
gcaacccaatttggtagcggctgggcttggttagtcctagacaacggtactttgaaagta
accaaaactggaaacgcagacaaccctatcaccgcagggcaaactcccctccttaccatg
gacgtatgggaacacgcttactacctagattatcaaaacaagcgtcctgcttatatcgat
gatttcttaggtaaattagtaaactgggattttgttgctcaaaacttagctgacgcttaa

DBGET integrated database retrieval system