KEGG   Cyanobacterium sp. HL-69: AA637_06520Help
Entry
AA637_06520       CDS       T05309                                 

Gene name
amyA
Definition
(GenBank) alpha-amylase AmyA
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cyl  Cyanobacterium sp. HL-69
Pathway
cyl00500  Starch and sucrose metabolism
cyl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AA637_06520 (amyA)
Enzymes [BR:cyl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AA637_06520 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939 Collagen_bind_2
Motif
Other DBs
NCBI-ProteinID: AUC60822
UniProt: A0A2K8WP53
LinkDB All DBs
Position
complement(1369718..1371199)
Genome map
AA seq 493 aa AA seqDB search
MSETNGVMMQYFHWYTEPDGNLWKEVAEKAQELADVGITALWLPPAYKGVAGGYDVGYGV
YDLYDLGEFDQKQSVRTKYGTKEEYLNAIKKAQSAGVHIYADMVFNHRLGADKSEEVNAT
PYNPQNRYEAMGEERNIKAWTHFTFPGRKGKYSDAELHWWYFDSVDYNAYEGDDDNAIYV
FEGKSFDEEVDLEHGNYDYLMGCNVDFSSEEVREDIKKWGEWYMDTTGVDGFRFDAVKHV
EATFFAEWLNHLRGYTKQDLFAVGEYWSYEVEALHHFITITDGHVALFDAPLHYNFAAAS
KQGSDYDLTTIFDNSLVKNEPSLAVTLVDNHDSQPLQSLESVVEGWFKPHAYALILLRRE
GYPCIFHADYYGAHYKDRGNDGEEYEIWLESHKWLIDKFLWVRQNCAYGEQYDYFDHPNT
IGWTRLGDEEHPGGVAVVLTNGEEGFKRMEVGQSNCEYMDLTEHIEQRVTTDDDGWADFP
CPPGSISVWIPVS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaactaatggcgtaatgatgcaatatttccactggtacacagagcctgatgga
aatttgtggaaagaagtagccgaaaaagctcaagaattagccgacgtaggtatcactgcc
ctatggttaccccccgcctataaaggagttgcaggaggttatgatgtgggttatggagtt
tacgatttatacgatttaggagaatttgatcaaaaacagtccgtaagaacaaaatacggc
accaaagaagaatatcttaacgccatcaaaaaagctcaatccgctggggtgcatatctac
gcagatatggtctttaatcatcgtctgggggcagataaatctgaggaagtcaacgcaacc
ccctacaacccccaaaatcgctatgaagccatgggagaggagagaaacattaaagcatgg
actcattttacttttcccggtcgtaaaggcaaatactctgatgcagaattacattggtgg
tattttgactcagtagattacaacgcctacgaaggtgacgatgataatgccatttatgta
tttgaaggtaaatcttttgatgaggaggttgatttagagcatggtaactatgattatttg
atgggttgtaatgtagattttagttccgaagaggtgagggaagatataaaaaaatggggt
gaatggtatatggacaccacgggggtggatggttttcgttttgatgcggtaaaacacgtt
gaagctacgttttttgccgagtggttaaatcatttacggggatatacaaaacaagatttg
tttgcggtgggggagtattggtcctatgaagtggaggcactacaccattttataaccatt
acggatggtcatgtggcgttatttgatgcccctttacattacaattttgcagcggctagc
aagcagggaagcgattatgatttaactacaatttttgataattccttggtaaaaaatgaa
ccgtctttagcggttactttagttgataaccatgactctcaacctttacaatctttggag
tcggtggtggaaggttggtttaaaccccatgcctatgccctaattttgcttagaagggag
ggttatccttgtattttccatgctgactattacggcgcccattacaaagataggggtaat
gatggggaagaatatgaaatatggttagaaagtcacaaatggttaatagataagtttttg
tgggtacgccaaaattgtgcttatggggagcaatatgactattttgatcatcctaatacc
atcggttggacaaggttgggggatgaagaacatccggggggagttgcggtggtgttaacg
aatggggaagagggttttaaaaggatggaagtgggacaatctaattgtgaatatatggat
ctaacagagcatattgagcaacgggttacgacggatgatgatggttgggctgattttcct
tgcccccctggttcaatttctgtgtggatacctgtttcctaa

DBGET integrated database retrieval system