KEGG   Cyanobacterium sp. HL-69: AA637_09865Help
Entry
AA637_09865       CDS       T05309                                 

Gene name
ddl
Definition
(GenBank) D-alanine-D-alanine ligase Ddl
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cyl  Cyanobacterium sp. HL-69
Pathway
cyl00473  D-Alanine metabolism
cyl00550  Peptidoglycan biosynthesis
cyl01100  Metabolic pathways
cyl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cyl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AA637_09865 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AA637_09865 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    AA637_09865 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cyl01011]
    AA637_09865 (ddl)
Enzymes [BR:cyl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AA637_09865 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:cyl01011]
 Precursor biosynthesis
  Amino acid ligase
   AA637_09865 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AUC61443
UniProt: A0A2K8WQT7
LinkDB All DBs
Position
complement(2071096..2072139)
Genome map
AA seq 347 aa AA seqDB search
MTTIKVGLLFGGRSGEHQVSIKSARAIAKALETGENKEKYQVIPFYINQNGVWLEPKKST
QILASCIPDDTDSQGSKWQFPAPCQEIQVWFPILHGPNGEDGTVQGLLTLMDVPFVGSGV
LGSALGMDKIAMKNAFAQAQLPQVAYVAVTRDEVLSGPCVFPKMCDRIDETLGYPCFVKP
ANLGSSVGIAKANTRQELEEALDMAAQYDTRIIVEAGVKAREVECAVLGNAQAKASVVGE
ITYDADFYDYETKYTDGKAQLIIPSQLPQNIVNQIQEMSLNAFHALNCQGLSRVDFFYVE
ETGEVLINEINTLPGFTTLSMYPQLWEASGVKFADLVDKLIDFALNP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaataaaggtaggactcttatttggtggacgttctggggaacatcaggtttca
attaaatcggcacgggcgatcgcaaaagccctagaaacaggagagaataaggaaaaatat
caggtaattcccttttatatcaatcaaaatggagtatggttagagcctaaaaaatcaacg
caaattttagcatcatgcatccctgacgacaccgattcccaaggctcaaaatggcaattt
ccagccccatgtcaagaaatacaagtgtggtttcctatcctacacggacccaatggagaa
gatggcacagtacaaggattattaactctgatggatgtaccctttgtgggaagtggtgtt
ttgggttcggctttgggtatggataagattgccatgaaaaatgcctttgcccaagcccaa
ctgccccaagttgcctatgttgccgttaccagagatgaagttttgtctggcccttgtgta
ttcccgaaaatgtgcgatcgcattgacgaaacccttggctatccctgctttgtaaaacct
gctaacctaggctcatctgtgggcattgccaaagccaacacccgtcaagaattagaagaa
gccctcgacatggcagcccaatatgatacccgtatcatcgtagaagcgggggtaaaagcc
agagaagtagagtgcgctgtgttgggcaacgcccaagccaaagcctccgtggtgggcgaa
attacctatgatgccgatttttatgactacgaaactaaatataccgacggcaaagcccag
ttaatcatcccctcccaactacctcaaaatatcgttaaccaaattcaagaaatgtccctc
aatgcattccatgccctcaattgtcaagggttatcaagggtggactttttctatgtggaa
gaaacaggggaagtgttaatcaacgaaatcaataccctacccggatttactaccctcagt
atgtatccccaattgtgggaagcatcaggggtaaaatttgccgatttggtggacaaatta
attgattttgccctcaatccatag

DBGET integrated database retrieval system