KEGG   Cyanobacterium sp. HL-69: AA637_12620Help
Entry
AA637_12620       CDS       T05309                                 

Gene name
mysD
Definition
(GenBank) D-alanine-D-alanine ligase MysD
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cyl  Cyanobacterium sp. HL-69
Pathway
cyl00473  D-Alanine metabolism
cyl00550  Peptidoglycan biosynthesis
cyl01100  Metabolic pathways
cyl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cyl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AA637_12620 (mysD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AA637_12620 (mysD)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AA637_12620 (mysD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cyl01011]
    AA637_12620 (mysD)
Enzymes [BR:cyl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AA637_12620 (mysD)
Peptidoglycan biosynthesis and degradation proteins [BR:cyl01011]
 Precursor biosynthesis
  Amino acid ligase
   AA637_12620 (mysD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AUC61934
UniProt: A0A2K8WS60
LinkDB All DBs
Position
complement(2604100..2605122)
Genome map
AA seq 340 aa AA seqDB search
MFTSEKPLKVLHIGGSLVSDFYDKLSLLYLKEVVQPPCVNPYYAVVHPDGLWQHGDSLTN
LSASKPLSDFLQEFPPIDVVVPHLFCEPGMTTVRGFFEDMLGFPVVGSKSSCTALATNKA
HTRDIVSANGVLVAKGQLLKQGDKVELKPPFIIKPNREDNSLGITLVKDETQIDEALKLG
FQYDSQLLAEEFIPGREIRVAVIDKGNKLEVLPMFEYLVTETNPIRTTAEKLELKEDGMP
QQQTPQPNVKAICPAHLTPELETKLSLAAIKAHGAIGCRDYSLYDFRVHQDTNEPYLLEA
GLFWAFSNISMISKMLLAKGENLDSVIFDVWCNAVQRFKN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtttacatcagagaaacccttaaaagtactacatatcggaggctctttagtgtccgat
ttttacgataaactttccttactttacctcaaagaagtagtacaacctccctgcgtaaac
ccctattatgcagtggtacatcccgatggattgtggcaacatggagactcattaaccaac
ctcagcgcctcgaaacccctatctgattttctccaagaattcccccccatagatgtggtc
gtaccccacttattttgtgaacctgggatgactaccgtaaggggcttttttgaggatatg
ttgggcttccccgtggtgggttcaaaatcttcctgcactgcccttgctaccaataaagcc
cacaccagagacattgtttcggctaatggggtattagtggcaaagggtcaacttttgaaa
caaggagataaggtggagttaaaaccaccttttattatcaaacccaatcgagaggataat
tctctaggaattacccttgtgaaagatgaaactcaaatcgatgaagccttgaaattaggt
tttcaatatgatagtcaacttttggcagaagagtttattcctgggcgagaaattcgggtg
gcagttattgacaagggtaataaattagaggttttgcccatgtttgaatatttagtcacc
gaaactaatcctattcgcactaccgcagaaaaactggaacttaaggaggatgggatgccc
caacaacaaactcctcaacctaatgtaaaagctatttgcccagcgcaccttaccccagaa
ttggaaactaagttaagtttagcagctatcaaagcccacggtgcgatcggttgtagagat
tattctctatatgattttagggtacatcaagatactaatgagccttatttgttggaagct
ggtttattttgggcttttagtaatatcagtatgatttctaaaatgttattggcaaaggga
gaaaatttagactcggtaatctttgatgtttggtgtaatgcggtgcaaagatttaagaat
taa

DBGET integrated database retrieval system