KEGG   Cyanobacterium sp. HL-69: AA637_14585Help
Entry
AA637_14585       CDS       T05309                                 

Gene name
ppcA
Definition
(GenBank) phosphoenolpyruvate carboxylase PpcA
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cyl  Cyanobacterium sp. HL-69
Pathway
cyl00620  Pyruvate metabolism
cyl00680  Methane metabolism
cyl00710  Carbon fixation in photosynthetic organisms
cyl01100  Metabolic pathways
cyl01120  Microbial metabolism in diverse environments
cyl01200  Carbon metabolism
Module
cyl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cyl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AA637_14585 (ppcA)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AA637_14585 (ppcA)
   00680 Methane metabolism
    AA637_14585 (ppcA)
Enzymes [BR:cyl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AA637_14585 (ppcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AUC62294
UniProt: A0A2K8WT68
LinkDB All DBs
Position
complement(2988020..2991091)
Genome map
AA seq 1023 aa AA seqDB search
MTFIKTNHKEEEELSIYSNSELLLRHRLKLVENLWELVLTNECGQHLVDLLDQLKSACSP
EGQTSETPKQSVSKWIEQLELDDAIKSVRALALYFQLINIVEQHYEQRNQKIIRSTTTED
QVNGNKIDSVIDKLIEGETQKVLVDSEGKDYSYFAQKPNPASGGTFHWLFPHLQQLNMPP
QKIQDLLDELDIRLVFTAHPTEIVRHTIRKKQRRISQILERLDGAEESCRAMGLTNSYEA
EHFRSRLMDEIQLWWRTDELHQFKPTVLDEVDYALHYFQEVLFDSLPHLSKRLQQALHST
FPKLKAPSHKFCYFGSWVGGDRDGNPFVTPEVTWSTACYQRNLVIDKYLESIVKLNDVLS
LSLHWSNVLPELLDSLETDRIKMPDVYDKLYVRYRQEPYRLKLAFIEKKLQNTKARNEAL
SNPETRKSIKLATRDDNLYPNASDFLEDLKLIKLNLEQTGLNCQELDHIIFQVEIYGFHL
AELDFRQDSSRHSDALNEIAQYLGMLDKPYNELSEEEKTQWLIGELKTRRPLVPNPIPFS
ETTTETIETFKILRSLQVEFGLEICNTYIISMTNYVSDVLEVLLLAKEAGLYDPVIGAST
IRIVPLFETVEDLKRSYSVMKELFDLPLYRACLAGGYEEVSTENQSNLVLPKLTPHNLQE
IMLGYSDSNKDSGFMSSNWEIHKAQKVLAKLGNTYGVKIKIFHGRGGSVGRGGGPAYAAI
LAQPTSTINGRIKITEQGEVLASKYSLPELALYNLETISTAVIQASLLGSGFDDIEPWND
IMEEIAIASRKAYRDLIYEQPDFIDFFLSVTPIEEISKLQISSRPARRKTGKKDISSLRA
IPWVFSWTQSRFLLPAWYGVGTALQEFLAKEPEENLKLLRYFYLKWPFFKMVISKVEMTL
SKVDLQMASHYVEELAKDEDKERFHKLFSQIAKEYYLSREMVLKINQQERLLDNDPELQR
SVQLRNGSIVPLGFLQVSLLKRLRQYASQDKAGLIHFRYSKDELLRGALLTINGIAAGMR
NTG
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgacttttatcaaaactaaccacaaagaagaagaagaactaagcatctattctaattca
gaactgttattgcgtcaccgactcaagctagtggaaaatttgtgggagttagttttgaca
aatgagtgtggacaacatttagtcgatttattagatcagttaaaatctgcttgttcccct
gaaggacaaacttcagaaacccccaaacaatctgtcagtaaatggattgagcagttagaa
ttagatgacgccatcaagtctgtacgggctttagctctctattttcaattaattaacatt
gtagagcaacattacgaacagcgaaaccaaaaaattatccgtagtaccaccaccgaagac
caagtaaatgggaataaaatagacagtgtcattgataaattaattgagggcgaaacccaa
aaggtacttgttgattctgaaggcaaagattatagttattttgcacaaaagccaaacccc
gccagtggtggtacttttcattggttatttccccatctacaacagttgaatatgccccct
caaaaaattcaagatttgttggatgagttagatattcgtttggtatttactgcccacccc
acagaaattgtgcgtcataccatccgcaaaaagcaaagacgcatttcccaaattttagag
cgtttggatggggcggaggaatcctgtcgtgccatgggtttaactaattcctatgaagca
gagcattttcgctctcgtttgatggatgagattcaattatggtggcgcaccgatgagtta
caccagtttaagcccacggttttggatgaggttgattatgcccttcattacttccaagag
gtgttatttgatagtttgccccacctttctaagcgtttacaacaggctttacatagcact
ttccctaaactaaaagcccctagtcataagttttgttattttggctcttgggtagggggc
gatcgcgatggaaatccatttgtaaccccagaagttacatggtcaacggcctgttatcag
cgtaatttagtcattgataaatatttagagtccatagtcaagttaaacgatgttctcagt
ttatccctccattggtctaatgtattaccagaattattagactccctagaaacagatcgc
atcaaaatgcctgatgtgtatgataaattatatgtccgttatcgccaagaaccctataga
ctaaaactcgcctttatcgagaaaaaattacaaaataccaaagcaagaaacgaggcttta
tccaaccccgaaacccgtaaatctattaaactagccacaagggatgataacctctacccc
aatgccagtgatttcttagaggacttaaaacttatcaagctcaaccttgagcaaacaggg
ctaaactgtcaagaattagaccatatcattttccaagtagaaatctatggttttcacctc
gccgagttggattttcgtcaagattcctcccgccattccgatgccctcaacgaaattgct
caatatttaggaatgttggataagccctacaatgaattgagcgaagaagaaaaaacccaa
tggctaatcggcgaattaaaaacccgtcgccccctcgtacccaatcccattcctttctcg
gaaactaccaccgaaaccattgaaaccttcaagattttacggtcattacaagtagaattt
ggtttggaaatttgtaacacctacatcatcagcatgacaaactatgtcagtgatgtatta
gaagttctcttgttggcaaaggaagcaggattgtatgaccctgttattggggctagtacc
attcgtatagtgcctttatttgagacggtggaagacttaaagaggtcctactcggtaatg
aaagaactctttgatttacccctttatcgtgcctgtttggcggggggatacgaggaggtt
tccactgaaaatcagtctaatttggtgctgcctaagttaactccccataatttacaggaa
atcatgcttggttattctgacagtaacaaggattctggatttatgagtagcaactgggaa
atccataaagcccaaaaagttttggcaaaattgggtaatacctatggggtaaaaatcaag
attttccacggtagaggaggctcggtgggtagggggggaggccctgcctatgcggcaatt
ttggctcaaccgacttctaccattaacgggcgcatcaaaattactgagcaaggggaggta
ctggcttctaagtattctttacctgagttggctttatacaatctcgaaaccattagcacc
gcagtaattcaggctagtttattgggcagtggattcgatgatattgaaccctggaacgat
attatggaagaaattgcgatcgcctccaggaaagcctatagagatttgatttatgagcaa
cctgacttcatcgatttcttcctttctgtcacccctatcgaggaaatcagtaaactacaa
attagctctcgccccgcccgtcgtaaaacaggcaaaaaagacattagctctttacgtgct
attccttgggtgtttagttggacacaaagccgtttcttgcttcctgcctggtatggtgta
ggtactgcattacaagagtttttagccaaagagcctgaagagaatctgaaactattacgt
tatttttatctaaaatggcctttcttcaaaatggtgatttccaaagtagaaatgaccctt
tcaaaggttgatttacaaatggctagtcactatgtagaagagttggcaaaggatgaggat
aaagagcgattccataagctattctcccaaattgctaaggaatattaccttagccgtgaa
atggtcttgaaaattaaccaacaagagcgattattagataatgatcccgaattacaacgt
tcggtacagttgcgtaacggttctattgtacctttagggtttttacaagtttcattgttg
aaacgtctgcgacaatatgcaagtcaagataaggctgggttgattcactttcgttacagc
aaggatgaattgttgaggggtgctttactcactattaatggcattgccgcgggaatgcgc
aacacaggttga

DBGET integrated database retrieval system