KEGG   Cyanothece sp. PCC 7425: Cyan7425_1199Help
Entry
Cyan7425_1199     CDS       T00836                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn00473  D-Alanine metabolism
cyn00550  Peptidoglycan biosynthesis
cyn01100  Metabolic pathways
cyn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cyn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Cyan7425_1199
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cyan7425_1199
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Cyan7425_1199
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cyn01011]
    Cyan7425_1199
Enzymes [BR:cyn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Cyan7425_1199
Peptidoglycan biosynthesis and degradation proteins [BR:cyn01011]
 Precursor biosynthesis
  Amino acid ligase
   Cyan7425_1199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ACL43579
UniProt: B8HLU1
LinkDB All DBs
Position
1035538..1036587
Genome map
AA seq 349 aa AA seqDB search
MTLRVGLLFGGCSGEHEVSIASARAIARALTTAPNSDRYTVLPFYIQKNGFWQGEEIAQQ
VLESGVPLADPVEGQPTQLWSFPHAAETVDVWFPILHGPNGEDGTVQGLLKLMQRPWVGS
GVLASAAGMDKIMMKTIFAAAGLPQVKYLAVNRSQLWSDPCVYTKLCDRIDTTLGYPCFV
KPANLGSSVGITKVRNRPQLETALENAASYDRRLVVETGVIAREVECSVLGNDHPRASVV
GEITYSSDFYDYETKYTDGRASLIIPADLPPAIVTQIQEMALTAFTAIDAAGLARVDFFY
LESTGEILINEINTLPGFTAFSMYPQLWAASGVTFPDLVDQLIQFALER
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgacactacgggtaggattgctatttggcggttgttccggtgaacacgaggtttccatt
gcctctgccagggcgatcgcccgtgctttgaccacagcccccaatagcgatcgctatact
gtgcttcctttctacattcagaaaaatgggttctggcaaggggaagagattgcccaacag
gtgctggagtctggtgtgcctctagccgatccggtggaggggcagcctacccaactctgg
agttttcctcatgcagcagaaactgtagatgtctggtttccaattttgcacggtccgaat
ggtgaagatggcaccgtacagggtttactcaaactgatgcaacgtccctgggtgggttcc
ggggtgctggcttcagcggcgggaatggacaagattatgatgaaaaccatttttgcggcg
gcaggcttaccccaggttaagtatttagcggtgaaccgctcccaactctggtcagatcct
tgcgtttataccaagctctgcgatcggattgataccaccctcggctatccctgttttgtc
aaacccgccaatcttggctcctccgttgggattacgaaagtacgcaatcgtccccagtta
gaaactgctttagaaaatgctgccagttacgatcggcgtttagtggtagaaacgggtgtg
attgccagagaagtggaatgttccgtgctgggtaatgatcatccccgtgcctctgtggtg
ggagaaattacctacagcagtgatttttatgactatgaaaccaagtacaccgatggccgg
gccagcctgatcattccggcagacttaccccctgcgatcgtcactcaaattcaggaaatg
gctctgacagcgtttacagcgattgatgcagcgggactggcgcgggtcgattttttctat
ctagaatcaacgggggagattttaattaatgaaattaacaccttgcccggtttcactgcg
ttcagtatgtacccgcaactctgggctgcctctggagtcacctttcccgatctggtggat
caactgattcaatttgctctagaacggtag

DBGET integrated database retrieval system