KEGG   Cyanothece sp. PCC 7425: Cyan7425_1438Help
Entry
Cyan7425_1438     CDS       T00836                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn00970  Aminoacyl-tRNA biosynthesis
cyn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cyan7425_1438
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cyn03029]
    Cyan7425_1438
Enzymes [BR:cyn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Cyan7425_1438
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Cyan7425_1438
Mitochondrial biogenesis [BR:cyn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Cyan7425_1438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey DUF4032 zf-Di19
Motif
Other DBs
NCBI-ProteinID: ACL43810
UniProt: B8HPE9
LinkDB All DBs
Position
complement(1275450..1276940)
Genome map
AA seq 496 aa AA seqDB search
MTTAAPAKVKTQYEAIIGLETHCQLKTATKIFCNCSTEFGAEPNHHVCPICMGMPGVLPV
LNQTVLEYAVKAGLALNCQIADYSKFDRKQYFYPDLPKNYQISQYDLPIAEHGWLEIELV
DAQGEPVRKKIGITRLHMEEDAGKLVHGGSERLSGSTFSLADYNRAGVPLCEIVSEPDLR
SGVEAAEYAQELRRILRYLEVCDGNMQEGSLRCDVNVSVRPVGSDKFGTKVEIKNMNSFN
AIQRAIDYEIERQIAQLEAGGRIVQETRLWDEASQQTISMRVKEGSSDYRYFPEPDLTPI
EVSEEQLDQWQLQLPELPAQKRHRYESELGLSAYDARVLTDDRPVALYFEATVAQGANPK
QAANWIMGDITAYLKTEKLAITDLPLSPTGLAELIGLIEAGTISSKIAKDLLPELLAEGG
SPKALVEQKGLTQISDSSALAGLIDQVLQDHPQELAQYRAGKTKLQGFFVGQIMKRSGGR
ADPKLTNQLLAEKLKG
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgactactgctgctccggcgaaagtaaaaacccagtacgaagcgatcatcgggctggaa
acccactgccaactgaaaaccgccactaaaatcttctgtaactgttcgacggaatttggg
gcggaaccgaaccaccacgtctgtccgatctgcatgggtatgcccggtgtgctgccagtt
ttgaaccagacggtgctggaatacgcggtcaaggcggggttggcgctcaactgtcagatt
gccgattacagcaagttcgatcgcaaacagtatttttatcccgatctgcccaaaaattat
cagatctcccagtacgacctgcccattgccgaacatggctggttagaaattgaactggtg
gatgctcagggcgaacctgtccgcaaaaagattggcatcacccgtctgcacatggaagaa
gatgcgggtaagctggttcacgggggcagtgagcggctatcgggttccacgttttccctg
gcagactataaccgggcgggggtgcccctctgtgaaattgtctcggagccagatttgcga
tcgggggtggaagcggcggaatatgcccaggaattgcggcggattttacgttacctggaa
gtctgtgatggcaacatgcaggaggggtcactgcgttgtgatgtgaacgtctcggtgcgg
ccggtgggttccgacaagtttggcaccaaggtcgaaatcaaaaacatgaactcctttaat
gccatccagcgggcgatcgactacgaaattgagcgccaaattgcccagttggaagcgggt
ggacggatcgtgcaggaaacacggctttgggatgaagccagccagcaaaccatcagcatg
cgggtgaaggaaggctccagtgattatcgctacttcccggaaccagacttaaccccgatc
gaagtgagtgaagagcaacttgatcaatggcagttgcaattacccgaactaccggcgcag
aaacggcatcgctatgaatcagaactgggactgtctgcctatgatgccagagtgctgacg
gacgatcgccccgttgccctgtactttgaagccaccgttgcccagggtgccaatcccaag
caggcggccaactggatcatgggggacatcaccgcctacctcaaaacggaaaaacttgcg
atcaccgatttacccttatcccccaccggactggcggaactgattggcttgattgaagcg
ggaacgatcagcagcaaaattgccaaagacctgctgccggaattgctggctgaaggagga
tcgcccaaggctctggtggagcagaagggcttgacccaaatctctgattccagtgccctg
gctggtttaattgatcaggtgctccaggatcatccccaggaactggctcagtatcgggcc
ggcaaaactaaactgcaaggtttctttgtgggtcaaatcatgaaacgttccggggggcgg
gccgaccccaagctgacaaatcaactcctggctgagaaactaaaaggataa

DBGET integrated database retrieval system