KEGG   Cyanothece sp. PCC 7425: Cyan7425_1660Help
Entry
Cyan7425_1660     CDS       T00836                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cyn  Cyanothece sp. PCC 7425
Brite
Enzymes [BR:cyn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Cyan7425_1660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Peptidase_C107
Motif
Other DBs
NCBI-ProteinID: ACL44029
UniProt: B8HQN9
LinkDB All DBs
Position
1502103..1502702
Genome map
AA seq 199 aa AA seqDB search
MAFEQPPLPYDPGALEPYGMSARTFEFHYGKHHAAYVTNLNNLTKDTELADKSLEEVIKV
TFKDPGKVGVFNNAAQVWNHTFFWNSLKPGGGGTPSGDLAAKIDSAFGSFDKFKEEFKTA
AATQFGSGWAWLVEDGGSLKVIKTPNAENPLAYGQKSLLTLDVWEHAYYIDYQNRRPDFI
QNFLDQLVNWDFVAQNLAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcctttgaacagcctcccttaccctacgatcccggtgcgttagagccttatggcatg
tctgcccggacgtttgagtttcactatggcaagcaccacgccgcctatgtcacgaacctg
aacaacctaaccaaagacacagaactggcggataagtccctggaagaggtgattaaagtc
acctttaaggatccgggcaaagtcggtgtcttcaataatgcggcccaggtttggaaccac
acgtttttctggaatagcctcaaacccggtggtggtggcacacccagtggagacctggcc
gccaaaattgacagtgcttttggtagtttcgataagttcaaggaagagttcaaaactgct
gctgcaacccaattcggcagtggatgggcttggctggtcgaagatgggggcagcctgaaa
gtgatcaaaacccccaatgctgaaaatcccctggcttatgggcaaaagtctctactcacc
ctggatgtgtgggaacatgcctactatattgattaccagaaccgtcgccctgactttatc
cagaatttcctggatcaactggtgaactgggactttgttgcccaaaatttggcggcttga

DBGET integrated database retrieval system