KEGG   Cyanothece sp. PCC 7425: Cyan7425_3166Help
Entry
Cyan7425_3166     CDS       T00836                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K08884  serine/threonine protein kinase, bacterial [EC:2.7.11.1]
Organism
cyn  Cyanothece sp. PCC 7425
Brite
KEGG Orthology (KO) [BR:cyn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cyn01001]
    Cyan7425_3166
Enzymes [BR:cyn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Cyan7425_3166
Protein kinases [BR:cyn01001]
 Serine/threonine kinases: Other
  Bacterial family
   Cyan7425_3166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH RIO1 Kdo
Motif
Other DBs
NCBI-ProteinID: ACL45494
UniProt: B8HN25
LinkDB All DBs
Position
complement(3138066..3139886)
Genome map
AA seq 606 aa AA seqDB search
MNYKSCRYYLVGLVGQGQFGRVFCGIDRHSGEIVALKQLDLRRFPTKSFLRELNFLLSLK
HANIVACQTIEHQGTSRYLVMDYCEGGTLRSLLESSERLQRLQILKIIADILQGLEYAHQ
RGIIHCDIKPENILLHVQADRWQACLSDFGVSRLSQELSRSGSGGLTGSPAYMAPERFYG
QYSYASDLYSVGVLLFEMLMGYRPFSGVPKELMAAHLNQPAQIPPTLPFLLRSILTTTLQ
KLPGHRYASTTAMLKAIRLAMEVEMAMEVEMTTETTTGFWIVPTEDATTEFKSLAREPLA
APFTHLAANERWMYGSTGYQVEYRTYSDCLTGELLQQQRVELPAAIAALYLRSQGCFILT
HPSDGDQRANFSLYHLHPNCDPALPLAPLLCWDAARPLLAIDPRSQWIAWVSHPSAPLGG
EGAPHLQLLKLPQHRQFGLTLDRDVPVAIAAVDQRYGVLVTAEDNPTQSRCRIFNRRGQW
LVEFKLPITCKQLTGGGERQLVFLSWEDPTTVFLVDLTPWKVRPISLSFSPEWIHPTSWG
YVLANRQGQVVVFSALGERMGNFAVPGTITAIAAFEPWGVLIATWEEEQGYLYTVDLRQL
DLEIVF
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgaactataaaagctgtcgttactacctggttggactggttggacagggacagttcggg
cgagtcttttgtggcatcgatcgccactcaggggaaattgttgcgctcaaacagcttgac
ctgcgtcgctttccaacaaaatcttttttgcgggaactaaacttcctgctcagccttaaa
catgccaatattgttgcctgtcagaccattgaacatcagggaaccagccgctatctggtg
atggattattgtgagggcggcaccctgcggtctttattagaaagtagcgaacggctgcaa
cggctgcaaatcctcaaaatcattgccgatattctccagggtttggagtatgcccaccag
cggggaattattcactgcgatattaagccggaaaatattctgctccatgtgcaggcagac
cgttggcaggcttgtctctccgactttggcgtgtcccgtctcagccaggaattatcgcga
tcgggcagtgggggtctgacgggttcaccggcctatatggctccagaacggttttatggt
caatactcctatgcttctgacctctacagtgtgggcgtgctgctgtttgaaatgctgatg
ggttaccgtcccttttcgggagtgcccaaagagctgatggcggcccatttgaatcaaccg
gctcagattcctcccaccttgccctttctgctgcgatcgatcctcaccactactttacag
aagctccctggccaccgctatgccagtaccactgccatgttgaaagcaattcggctggcc
atggaagtagaaatggccatggaagtggaaatgactacggagactactacaggattctgg
atcgtaccgactgaggatgctactacagagtttaagagcctggctcgggaacctttagcc
gctcctttcacccatctggcggcaaacgagcgatggatgtatggcagcacgggctatcag
gtagaataccgcacctatagcgattgtttgactggggaattactgcagcagcaacgggtg
gaattaccggcggcgatcgcggctctctatttgcgttcccagggctgttttatcctgacc
cacccctccgacggggatcaacgggctaacttttctctataccatctccatcctaattgc
gatcctgctctaccccttgcgcctcttctctgctgggatgcagcccgacccttgctggcc
atcgatccccgcagtcaatggattgcctgggtgtcgcatccgtctgccccccttggagga
gaaggagccccgcacctccagttgctcaaattgccccagcaccgacaatttgggttaacc
ctggacagagatgtacccgtggcgatcgcggcggtggatcaacgctatggtgtactggtt
acagctgaggacaacccaactcagtcccgatgtcgcatctttaaccgtcgagggcagtgg
ttagtcgaatttaaactgcccatcacctgtaagcaactcacaggggggggagaacggcaa
ttggtattcctgtcctgggaggatcccaccacagtctttctggtagatctcacaccctgg
aaagtccggcccatttccctcagctttagcccggaatggattcatcccacctcctggggg
tatgtgctagccaaccgtcagggccaggtggtcgtgttcagtgctctgggcgaacgcatg
ggtaacttcgctgtccccggaacgatcactgcaatcgctgcctttgaaccctggggggtg
ttgattgctacctgggaggaggaacaggggtatctctacactgtagatctgcgccaatta
gacctggagattgtattctag

DBGET integrated database retrieval system