KEGG   Cyanothece sp. PCC 7425: Cyan7425_3420Help
Entry
Cyan7425_3420     CDS       T00836                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn00630  Glyoxylate and dicarboxylate metabolism
cyn00710  Carbon fixation in photosynthetic organisms
cyn01100  Metabolic pathways
cyn01120  Microbial metabolism in diverse environments
cyn01200  Carbon metabolism
Module
cyn_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cyn_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
cyn_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cyn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Cyan7425_3420
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan7425_3420
Enzymes [BR:cyn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Cyan7425_3420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ACL45744
UniProt: B8HQS3
LinkDB All DBs
Position
complement(3372003..3372347)
Genome map
AA seq 114 aa AA seqDB search
MKTLPKERRYETFSYLPPLSDAQIARQIQYTLDQGYIPAVEFNEDSNAETYYWTMWKLPL
FNATSPQEVLNEVQQCRSEYSGSYIRVVAFDNVKQCQVMSFIVHKPNASGGYRY
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgttacccaaagagcgtcgttacgaaaccttttcctacttgcctcctctcagc
gatgctcaaattgcccggcaaattcaatacaccctggatcagggctatattcctgccgta
gagttcaacgaagactctaatgctgaaacttactactggaccatgtggaagttacccctg
tttaacgccaccagcccccaggaagtgttgaatgaagtgcagcagtgccgttcggaatat
agtggcagctacattcgtgttgttgcttttgacaatgtcaagcaatgtcaggtgatgagc
ttcattgtgcataaacccaatgccagtggtggctatcgctactaa

DBGET integrated database retrieval system