KEGG   Cyanothece sp. PCC 7425: Cyan7425_4177Help
Entry
Cyan7425_4177     CDS       T00836                                 

Definition
(GenBank) glycosyl transferase family 2
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cyn01003]
    Cyan7425_4177
Enzymes [BR:cyn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     Cyan7425_4177
Glycosyltransferases [BR:cyn01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   Cyan7425_4177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 GtrA Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: ACL46490
UniProt: B8HXE5
LinkDB All DBs
Position
4228795..4230093
Genome map
AA seq 432 aa AA seqDB search
MKIQSLTQRLLNLRLTKFLFAGGVAFLINVLILALLINYWQWNTPILRNLANIVSIEISL
VFSFFIYRTWVWPGGSWSISEVILRQLPLYHFSGGMVILLRIFLIFPLLDWLKVNYAINT
LIGVLIGAIINYVINDRLIFQKKSLDKINGKAIPDIYYPEGLELAVRPPVKTPVCANANT
SLQLLSIIIPAYNEEECIAETIQGITQYLNAYEIDYEIVVINDNSRDHTEDILKALQQEN
PRIRYLNSYYPNGFGFAVRCGLENFCGDAAVIVMADGSDPPENILNYYYKLQEGYDCVFG
SRFIKGGKVVDYPQHKLIINRLANLFVQVLFGLKLNDTTNAFKIYRREVIEGVQPLISHH
FNLTVEIPLKAIVRGYSYAVVPIAWYNRKAGISKLKLKEMGSRYLFIVLYILLEKLLSQG
DYVRRRSPKIRL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaagatacaaagccttacccaacgcctgctaaatttacgactcactaagtttcttttc
gcgggtggcgttgcatttctgattaatgtcctcattcttgccctgctcattaattactgg
cagtggaacacacccattttacgtaaccttgctaatattgtctcaattgaaatatcttta
gttttcagtttctttatttatagaacttgggtctggccaggagggagctggtctatttca
gaagtcattctgcgtcagcttccgctataccacttttctggtggaatggtaatcttactg
agaatttttctaatttttcctttacttgactggttaaaagttaactatgcaattaatacg
ctcattggtgtgttaattggcgcaattataaactatgtcatcaacgatcggttgatattc
caaaaaaaatcattagataaaatcaatggaaaagcaataccagatatttattatccagaa
gggcttgaactagctgttagaccccctgtcaaaactcctgtctgtgccaacgctaacact
tccttgcaattactttccatcatcattccagcctataacgaagaagagtgcatcgcagag
acaattcagggaattactcagtacttaaatgcttatgaaatagattacgaaatcgttgtt
atcaacgataatagccgagaccatacggaagatattttaaaagcactccagcaagagaat
ccgcggatcaggtacttaaatagttactatcccaatggatttggctttgcagtccgctgt
ggtctggaaaacttttgtggcgatgccgccgtaatcgtcatggctgatggctcagatcct
ccagaaaatattttaaactattactataagcttcaagaagggtatgattgtgtttttggc
tctagatttattaaaggtggcaaggttgttgattatccccagcacaaattgatcattaat
cgcctggctaacttgtttgttcaggtcttgtttggcttaaagttgaatgatacaaccaac
gcgtttaagatttatcgacgggaagtgattgaaggggtacagcctctgatttctcaccac
tttaacctaactgttgaaatccctttgaaggcgatcgttcgcggttattcctacgcggtg
gtgcctatcgcctggtataaccgaaaagcgggtatatccaaactcaagctaaaggagatg
ggcagtcgctatctattcattgtcctttatattcttttggagaaactgctttctcaaggg
gactatgtccgccgccgctctcctaaaatcaggttatag

DBGET integrated database retrieval system