KEGG   Cyanothece sp. PCC 7425: Cyan7425_4977
Entry
Cyan7425_4977     CDS       T00836                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn00010  Glycolysis / Gluconeogenesis
cyn00020  Citrate cycle (TCA cycle)
cyn00620  Pyruvate metabolism
cyn01100  Metabolic pathways
cyn01110  Biosynthesis of secondary metabolites
cyn01120  Microbial metabolism in diverse environments
cyn01200  Carbon metabolism
Module
cyn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan7425_4977
   00020 Citrate cycle (TCA cycle)
    Cyan7425_4977
   00620 Pyruvate metabolism
    Cyan7425_4977
Enzymes [BR:cyn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cyan7425_4977
SSDB
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl PASTA
Other DBs
NCBI-ProteinID: ACL47275
UniProt: B8HNE8
LinkDB
Position
complement(5062119..5063417)
AA seq 432 aa
MIHEVFMPALSSTMTEGKIVSWTKSPGDKIAKGETVVIVESDKADMDVESFYEGYLAAIS
TPAGSVAPVGATIGLVAETEAEIAEAQAKVAQQASSAPAPAAETVPSPVATSPVEIKAEP
GLALATPSGRTVASPRARKLAKELNIDLSTLRGSGPHGRIVAEDVEAAAGLVKAAPAIAL
PTAPAPQPNGHRTPTPAVTAPTVAPAVMPGETVPLSTLQQAVVRNMLASLEIPDFHVAYT
LTTDALDQLYKQIKSKGVTMTALLAKAVALTLQKHPIINACYSDGGIQYRANINIAIAVA
MPGGGLITPVLKNADQQDIYSLSRTWKDLVERARAKQLQPDEYTTGTFSLSNLGMYGVDS
FDAILTPGQGAIMAIGAALPQVVATEDGLFGIKRQMKVNITCDHRVIYGADAAAFLQDLA
KLVATDPQALLL
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgatccatgaagttttcatgcccgcccttagctccaccatgacggaaggtaagattgtc
tcctggacaaaatcccctggggacaaaattgccaaaggggaaacggtggtgatcgtggag
tcagacaaggctgacatggatgtggagtccttctatgagggctatctggctgcgatctcc
acgcctgccggtagtgttgcccccgtcggagccacgatcggtctggttgcggaaacagag
gcagaaattgctgaagctcaggctaaagttgctcaacaagcttcttctgcgccagccccc
gccgctgagacggttcccagtccggttgccaccagcccggttgagatcaaagctgagcct
ggtcttgccctggccacgccttcaggacgcacggtggcttctccccgggcccgcaagctg
gctaaagaactcaacattgatctgagtacgctgcggggaagtggcccccacggtcgaatt
gtggcggaagatgtggaagctgcagcgggattggtcaaagcagccccggcgatcgctcta
cccacggctccggctccccaacccaatggccaccgtacccccaccccagcggttacagct
ccaacggtggctccagcggtgatgcccggcgaaacggttcccctcagcactttgcagcag
gctgtggtgcgcaatatgctggccagtctggagatcccggacttccacgttgcctacacc
ctcaccactgatgcccttgatcagttgtacaagcagattaagtcgaaaggcgtgacaatg
acagcgttactggctaaggccgttgccctgacgctgcaaaagcatccgatcatcaatgcc
tgctatagcgacgggggcattcagtatcgcgccaacattaacattgccattgccgttgcc
atgcccggtgggggtttaattaccccagtgcttaaaaatgctgaccagcaggatatttat
agcctgtcccgtacctggaaagacctggtggagcgggcccgagccaagcaactccagccg
gatgaatacaccaccgggaccttcagcctgtctaatctcggtatgtatggggtggatagt
tttgatgctattctcacccccggtcagggtgcgattatggcgatcggcgctgcccttccc
caggttgtggctacagaagacggcctgtttgggatcaaacggcagatgaaagtgaacatc
acctgtgatcaccgcgtgatctatggtgcagatgccgccgccttcctccaggatctggct
aagctggtagctaccgatccccaggctttattgctctaa

DBGET integrated database retrieval system