KEGG   Citrobacter youngae: CD187_05670Help
Entry
CD187_05670       CDS       T05526                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
cyo  Citrobacter youngae
Pathway
cyo00250  Alanine, aspartate and glutamate metabolism
cyo00280  Valine, leucine and isoleucine degradation
cyo00310  Lysine degradation
cyo00410  beta-Alanine metabolism
cyo00640  Propanoate metabolism
cyo00650  Butanoate metabolism
cyo01100  Metabolic pathways
cyo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cyo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CD187_05670
   00650 Butanoate metabolism
    CD187_05670
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CD187_05670
   00280 Valine, leucine and isoleucine degradation
    CD187_05670
   00310 Lysine degradation
    CD187_05670
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CD187_05670
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cyo01007]
    CD187_05670
Enzymes [BR:cyo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CD187_05670
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CD187_05670
    2.6.1.48  5-aminovalerate transaminase
     CD187_05670
Amino acid related enzymes [BR:cyo01007]
 Aminotransferase (transaminase)
  Class III
   CD187_05670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AWV25751
UniProt: A0A2U9UDX4
LinkDB All DBs
Position
complement(1140289..1141572)
Genome map
AA seq 427 aa AA seqDB search
MSTNKELMQRRSNAVPRGVGQIHPIFAERAENCRVWDVEGREFLDFAGGIAVLNTGHLHP
QIVSAVEAQLKKLSHTCFQVLAYEPYLELCEIMNKKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRTGTIAFSGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDVAAIVIEPVQGEGGFYAASPSFMQRLRAICDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAIPPGGLGGTYAG
NPIACAAALAVLNIFEQENLLQKANELGQTLREGLLAIAETHREIGDVRGLGAMIAIELF
ENGDHMKPDAKLTAEVVARAREKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLDIIAQC
FAEAKQG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaacaaagaacttatgcaacgtcgcagcaacgccgttccccgtggcgtaggc
cagatccaccctatttttgccgagcgggcagaaaactgtcgggtctgggacgttgaaggc
cgtgaattcctcgactttgctggcggtattgcggtgctgaacaccggtcacctgcatccg
cagatcgtctctgcggtagaagcgcagttgaaaaagctgtcccatacctgtttccaggtg
ctggcatatgagccgtacctggagctgtgtgaaatcatgaataagaaagtgccgggtgat
ttcgccaagaaaaccctgctggtgaccaccggttctgaagcggtagaaaacgcggtgaaa
atcgcccgcgccgccaccaagcgtacggggactatcgcctttagcggcgcttaccacggt
cgtacccactacaccctgtcactgaccgggaaagtcaatccgtactccgccggaatgggg
ctgatgccgggccacgtgtatcgcgcgctttatccttgccctctgcacggcatcagtgaa
gatgatgctatcgccagcattcaccgcattttcaaaaacgatgccgcgccagaagacgtc
gccgccattgtgattgaacccgttcagggcgaaggtggcttttacgcagcctctccttcc
tttatgcaacggctgcgcgccatttgtgacgaacacgggatcatgctgattgccgatgaa
gtacagagcggtgcgggccgtaccggtacgctgtttgccatggagcagatgggcgttgcg
cccgatctcaccaccttcgccaaatccatcgccggcggcttcccgctggcgggcgtgacc
ggacgcgccgaagtcatggacgcaatcccaccgggcggcctgggcggtacctatgcaggt
aacccaattgcctgcgccgccgcgctggcggtactgaacattttcgagcaggaaaatctg
ttgcaaaaagccaacgagctggggcaaaccctgcgcgaaggcctgctggctatcgcggaa
acccatcgcgagattggcgacgtacgcgggctgggcgcgatgattgctatcgaactgttc
gaaaacggcgaccacatgaaaccagacgccaaactgactgcggaagtggtggcgcgtgca
cgcgagaaaggactgatcctgctctcctgcggaccttactacaacgtgctgcgcattctt
gtcccgctgaccattgaagatgcgcaaatccgccagggactggacattatcgcccagtgt
tttgccgaggcaaagcagggttaa

DBGET integrated database retrieval system