KEGG   Citrobacter youngae: CD187_08170Help
Entry
CD187_08170       CDS       T05526                                 

Definition
(GenBank) ABC transporter substrate-binding protein
  KO
K13893  microcin C transport system substrate-binding protein
Organism
cyo  Citrobacter youngae
Pathway
cyo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cyo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CD187_08170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cyo02000]
    CD187_08170
Transporters [BR:cyo02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Microcin C transporter
    CD187_08170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: AWV26202
LinkDB All DBs
Position
complement(1685940..1687754)
Genome map
AA seq 604 aa AA seqDB search
MIPRVLLLFITLIGFSAQAQSIKESYAFAVLGEPKYAFNFNHFDYVNPAAPKGGQITLSA
IGTFDNFNRYAMRGNPGARTETLYDTLFTTSDDEPGSYYPLIADSARYANDYSWVEIAIN
PRARFHDGSPITARDVAFTFHKFMTEGVPQFRLVYKGTTVKAIAPLTVRIELAKPGKEDM
LSLFSLPVMPEKYWKDHKLSDPLSSPPLASGPYRITKWKMGQYIVYSRVKDYWAANLPVN
RGRWNFDTIRYDYYLDDNVAFEAFKAGAFDLRLENDAKNWATRYTGKNFANHYIIKDEQK
NESAQDTRWLAFNIQRPVFSDRRVREAITLAFDFEWMNKALFYNAWSRTNSYFQNTEYAA
TKYPDADELVILAPLKKDLPSEVFSQIYQPPKSKGDGYDRDNLLKADTLLEQAGWVLKGQ
QRVNSASGKPLSFELLLPAGSNSQWVLPFQHNLQRLGITMNIRQVDNSQITNRLRSRDYD
MMPRLYRAMPWPSSDLQILWASQYIDSSYNAPGVQSPVIDKLIDQIIAAQGDKAKLIPLG
RALDRVLTWNYYMLPMWFMAEDRIAWWDKFSHPAIRPIYTIGLDNWWYDVNKAAKLPAAR
RQGE
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgatccctcgcgtactgcttctgtttattaccctcatcgggtttagcgcccaggcgcaa
tccatcaaagaaagctatgcttttgccgtactgggtgaaccgaagtacgcatttaacttt
aatcatttcgattatgtgaatcccgcagcccctaaagggggtcaaatcaccctgtccgcc
attggcacgtttgacaactttaaccgctatgcgatgcgcggtaaccccggcgcacgtacc
gaaacgctttacgatacgttgtttacgacctctgacgatgaacctggtagctattacccg
ctcattgccgacagcgcacgctatgctaacgactattcctgggtagaaattgccattaat
ccacgagcgcgttttcacgatggctcacccattaccgcccgcgacgtcgcattcaccttc
cacaaatttatgactgaaggcgtgccgcagtttcgtctggtctacaagggaacaacggta
aaagccatcgcgccattaaccgtacgcattgaattagccaaaccgggtaaagaggacatg
ctcagcctgttttcattacccgtgatgccagagaagtactggaaagatcataagctcagc
gatcccttatcatcgccaccgctcgccagcggcccttatcgcattacgaaatggaagatg
ggccagtatattgtctattcgcgcgtcaaagattattgggccgctaatctgcccgtcaat
cgtggacgctggaactttgataccatccgctacgactactatctggatgataacgtcgcc
tttgaagcgtttaaggccggtgcgtttgatctgcgtcttgaaaatgatgccaaaaactgg
gcgacgcgttataccgggaaaaatttcgcgaatcattacatcatcaaagatgagcaaaaa
aacgagtccgcgcaggatacccgctggctggcatttaatattcagcgtccggtattcagc
gaccgacgggtacgggaagccatcacgctggcctttgattttgaatggatgaataaagcg
ctgttctataatgcctggagccggaccaacagctattttcagaataccgaatatgccgcg
acaaaataccccgacgcagatgagctggtgatactcgcgcccttgaaaaaagatctcccc
tctgaggtctttagccaaatctatcagccgccaaaatcaaaaggcgatggctacgaccgc
gacaacctgttgaaagccgataccttactggagcaggccgggtgggtactaaagggtcag
cagcgcgtaaacagcgccagcggtaaacctctgagctttgaactgttgctcccggcgggc
agcaacagtcagtgggtgctgccgttccagcacaacctgcagcgcttaggtattaccatg
aatatccgccaggtggataactcacaaatcacgaaccgcctgcgcagtcgcgactatgac
atgatgccgaggttgtatcgcgcgatgccgtggccgagttcggacctgcaaattctgtgg
gcctctcaatatattgattccagctacaacgcccccggcgtacaaagcccggtgattgat
aaactgatcgaccaaatcatcgcggcacaaggtgataaagccaaattgatcccactaggc
cgggcactggacagggtattaacctggaactactacatgttgccgatgtggtttatggca
gaggatcgcatcgcctggtgggataaattttcgcatcctgctattcgcccaatttacacc
attggcctcgacaactggtggtatgacgtcaacaaagcggcgaaactgcccgctgccaga
cgacagggagaataa

DBGET integrated database retrieval system