KEGG   Citrobacter youngae: CD187_11775Help
Entry
CD187_11775       CDS       T05526                                 

Gene name
fdxH
Definition
(GenBank) formate dehydrogenase subunit beta
  KO
K08349  formate dehydrogenase-N, beta subunit
Organism
cyo  Citrobacter youngae
Pathway
cyo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cyo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CD187_11775 (fdxH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Form-deh_trans Fer4_7 Fer4_10 Fer4_9 Fer4_6 Fer4_2 Fer4 Fer4_21 Fer4_16 Fer4_4 Fer4_3 Fer4_17 Fer4_13 Fer4_8 Fer4_18 Fer4_20 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AWV26867
LinkDB All DBs
Position
2409931..2410815
Genome map
AA seq 294 aa AA seqDB search
MSMETQDIIKRSATNSITPPPQARDYKAEVAKLIDVSTCIGCKACQVACSEWNDIRDEVG
HCVGVYDNPADLSAKSWTVMRFTETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQ
YANGIVDFQSEHCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCP
TGAIHFGTKQEMLEMGEQRVAKLKARGFEHAGLYNPEGVGGTHVMYVLHHANQPELYHGL
PKDPQIDTSINLWKGALKPLAAAGFIATFAGLIYHYIGIGPNKEVDDDEEDHHE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtctatggaaacgcaggacatcatcaaacggtccgcaacaaactccatcacgccgccg
cctcaggctcgtgattacaaagcagaggtcgcgaagctgatcgacgtttccacctgcata
ggctgtaaagcctgtcaggtggcatgctcagagtggaacgatatccgcgatgaagtcggc
cactgcgtcggggtttatgacaaccccgccgatctcagcgccaagtcctggacggtgatg
cggtttaccgaaaccgaacagaacggcaagctggagtggttgattcgtaaagacggctgt
atgcactgtgaagatccgggctgcctgaaggcgtgcccgtctgccggggccatcatccag
tacgccaacgggattgtcgatttccagtcagagcactgcattggctgcggctactgtatt
gccgggtgtccatttaatattccgcgcctcaataaagaggataaccgcgtgtataaatgt
acgctgtgtgtggaccgcgtcagcgtcgggcaggaacctgcctgcgtgaaaacgtgtcct
accggggcaatacatttcggcaccaagcaggaaatgctggaaatgggtgaacagcgtgtg
gcaaaactgaaagctcgcggttttgaacatgccggtctttacaacccggaaggtgtgggc
ggcacgcacgtcatgtacgttctgcatcacgccaaccagcctgaactgtatcacggcctg
ccaaaagacccgcagatagatacctctatcaatctgtggaaaggggcgctgaagccgctg
gccgctgccggatttatcgccaccttcgccggactgatttaccactacattggtattggt
ccgaataaggaagtggacgacgacgaggaggatcatcatgagtaa

DBGET integrated database retrieval system