KEGG   Citrobacter youngae: CD187_13510Help
Entry
CD187_13510       CDS       T05526                                 

Definition
(GenBank) 6-phosphofructokinase II
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
cyo  Citrobacter youngae
Pathway
cyo00010  Glycolysis / Gluconeogenesis
cyo00030  Pentose phosphate pathway
cyo00051  Fructose and mannose metabolism
cyo00052  Galactose metabolism
cyo00680  Methane metabolism
cyo01100  Metabolic pathways
cyo01110  Biosynthesis of secondary metabolites
cyo01120  Microbial metabolism in diverse environments
cyo01130  Biosynthesis of antibiotics
cyo01200  Carbon metabolism
cyo01230  Biosynthesis of amino acids
Module
cyo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cyo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD187_13510
   00030 Pentose phosphate pathway
    CD187_13510
   00051 Fructose and mannose metabolism
    CD187_13510
   00052 Galactose metabolism
    CD187_13510
  09102 Energy metabolism
   00680 Methane metabolism
    CD187_13510
Enzymes [BR:cyo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CD187_13510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AWV27182
UniProt: A0A2U9UPY5
LinkDB All DBs
Position
2759139..2760068
Genome map
AA seq 309 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCTSPVFEPGGGGINVARAIAHLGGTATAIFP
AGGATGEHLVALLADENVPVSTVEAKDWTRQNLHVHVESSGEQYRFVMPGAALTDDEFYQ
LQDQVLEIESGALLVISGSLPPGVQLEKLTRLITTAQKQGIRCIVDSSGEALTAALAIGN
IELVKPNLKELSALVNRELTQPDDVRKAAQEIIQSGKAHRVVVSLGPQGALGVDRDTCVQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAENAPFEDIVRYGVAAGSAATLNQGTRLCALDDT
QKIYAYLAQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttaacacttgcgccctctctcgatagcgcaacaatcaccccg
caaatttacccggaaggtaagcttcgttgtacctcgccggtttttgaacccggcggcggc
ggtatcaacgtcgctcgcgcaattgcccatcttggcggaaccgcaacagcgattttcccc
gcggggggagcaaccggagagcatcttgttgcattgctcgccgacgaaaatgttcccgta
tctaccgtcgaagccaaagactggacccgacaaaatcttcatgtccacgtggagtccagc
ggcgaacaatatcgttttgtcatgccaggcgctgcgctgaccgatgacgagttctaccaa
cttcaggatcaggtgctggaaattgagtctggtgcgctgctggtcatcagcggcagtttg
ccgcccggcgtacagcttgagaagttgacccgactcattaccaccgcacaaaaacagggg
atccgctgtattgtcgacagttcaggcgaagcactgacggcggcgttagccatcggcaat
atcgaactggtcaaacccaacctcaaagaactgagtgcgctggtaaaccgcgaactgaca
cagcccgatgatgtgcgcaaggccgcacaggaaatcatacagagtgggaaagcgcaccgc
gttgtggtctcgcttgggccgcaaggggcgctgggcgtagatcgagatacctgcgttcag
gtggttccgccaccggtgaaaagtcaaagcaccgtaggtgcaggcgacagtatggtcgga
gccatgacgcttaaactggcagagaacgcgccttttgaggatattgtccgttacggtgtc
gccgccggtagcgcagcaaccctgaatcagggtacgcgtctgtgcgctttggacgatacg
caaaaaatatatgcataccttgcgcagtaa

DBGET integrated database retrieval system