KEGG   Citrobacter youngae: CD187_16675Help
Entry
CD187_16675       CDS       T05526                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cyo  Citrobacter youngae
Pathway
cyo00020  Citrate cycle (TCA cycle)
cyo00190  Oxidative phosphorylation
cyo00650  Butanoate metabolism
cyo01100  Metabolic pathways
cyo01110  Biosynthesis of secondary metabolites
cyo01120  Microbial metabolism in diverse environments
cyo01130  Biosynthesis of antibiotics
cyo01200  Carbon metabolism
Module
cyo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cyo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cyo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cyo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CD187_16675 (sdhB)
   00650 Butanoate metabolism
    CD187_16675 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CD187_16675 (sdhB)
Enzymes [BR:cyo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CD187_16675 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     CD187_16675 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: AWV27754
UniProt: A0A2U9UGD6
LinkDB All DBs
Position
complement(3366857..3367573)
Genome map
AA seq 238 aa AA seqDB search
MKLEFSVYRYNPDVDDAPRMQDYTLEAEEGRDMMLLDALMQLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVVRDLVVDMGQFYAQYEKIKPY
LLNNGKNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETDSRLEGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLKRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgagttttcagtttatcgctataacccggatgttgacgacgctccgcgcatg
caggattacaccctggaggcggaagaagggcgcgacatgatgctgctggatgccttgatg
cagctgaaagaaaaagatccgtcgctgtcgttccgccgctcttgccgtgagggggtttgt
ggctccgacggtctgaacatgaacggcaaaaatggactggcctgtatcactcctatttct
gcgctgaatcagccgggcaaaaaaattgtcattcgcccgctgccgggtttaccggttgtg
cgcgatttggtggtagacatggggcaattctacgcacagtatgagaagattaagccttac
ttgttgaataatgggaaaaatccgccagcacgtgagcatttacaaatgccagagcagcgt
gagaagctcgatgggctgtatgaatgtattttgtgtgcatgctgctcaacgtcctgccca
tcattctggtggaacccggacaagtttattggcccggcaggtctgctggcagcgtatcgc
ttcttaattgatagccgcgataccgagaccgacagccgcctggaaggtttaagtgacgct
ttcagcgtattccgctgccatagcatcatgaactgcgtcagcgtatgtccgaaaggactg
aacccgacgcgcgccattggccatattaagtcgatgctgctcaaacgtagtgcgtaa

DBGET integrated database retrieval system