KEGG   Citrobacter youngae: CD187_16680Help
Entry
CD187_16680       CDS       T05526                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cyo  Citrobacter youngae
Pathway
cyo00020  Citrate cycle (TCA cycle)
cyo00190  Oxidative phosphorylation
cyo00650  Butanoate metabolism
cyo01100  Metabolic pathways
cyo01110  Biosynthesis of secondary metabolites
cyo01120  Microbial metabolism in diverse environments
cyo01130  Biosynthesis of antibiotics
cyo01200  Carbon metabolism
Module
cyo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cyo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cyo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cyo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CD187_16680
   00650 Butanoate metabolism
    CD187_16680
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CD187_16680
Enzymes [BR:cyo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CD187_16680
    1.3.5.4  fumarate reductase (quinol)
     CD187_16680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: AWV27755
UniProt: A0A2U9UCQ9
LinkDB All DBs
Position
complement(3367589..3369355)
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELDHMGLPFSRLDNGTIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNADGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEQGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAVGLHLQ
ESIAEQGDLLDATEDEIDASLARLNRWNGNRNGEDPVAIRKALQECMQHNFSVFREGDAM
AKGLEELKAIRERLKNARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAH
SRFDFPERDDENWLCHSLYLPESESMTRRQVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccagtcagagaatttgatgctgttgtgattggtgccggcggcgcaggtatg
cgcgcggcgctgcaaatttcccagagcggtcagacctgtgcgctgctctccaaagtgttc
ccaacccgttcccataccgtatccgcgcagggtggcatcaccgttgcgctcggtaatacc
catgaagataactgggaatggcacatgtacgacaccgttaaagggtcggactacattggt
gaccaggacgctattgaatatatgtgtaaaaccggtccggaagcgattctggagctggac
cacatggggctgccgttctctcgcctcgacaatggcacaatttatcaacgtccgtttggc
ggccagtcgaagaacttcggcggcgagcaggcggctcgtactgcggcagcggccgaccgt
accggtcatgcgctgttgcacacgctgtatcagcagaacctgaaaaaccataccaccatc
ttctccgagtggtatgcgctggacctggtgaaaaacgccgatggcgcagttgtcggttgt
accgcgctgtgtatcgaaaccggtgaagtggtttacttcaaagcccgcgcgactgtgctg
gccaccggcggtgctggccgtatttatcagtccactactaatgcccacatcaataccggt
gacggtgttggtatggctatccgcgctggcgtgccggtgcaggatatggagatgtggcag
ttccacccaaccggtatcgccggtgcaggcgttctggtaacagaaggctgccgtggtgaa
ggtggctacctgctgaacaaacacggcgagcgcttcatggagcgttatgccccgaatgcg
aaagacctggcgggtcgtgacgtggtggcgcgttccatcatgatcgaaattcgcgaaggt
cgcggctgcgacggcccgtggggtccgcacgccaaactgaaactcgaccacctgggtaaa
gaagtgctggaatcccgtctgccgggtattctcgaactgtcccgtacctttgctcacgtt
gacccggtcaaagagccgattccggttatcccaacctgccactatatgatgggcggtatt
ccgaccaaagtaactggccaggcgttgaccgtgaatgagcagggcgaagatgtggtgatc
cctgggctgtttgccgtcggcgaaatcgcctgcgtatcggttcacggcgccaaccgtctg
ggcggcaactcgctgctggacctggtagtatttggtcgtgcggttggtctgcatctgcag
gaatccatcgctgagcagggtgacctgctggatgcgaccgaagatgaaatcgacgcttct
ctggcgcgtctgaaccgctggaacggtaaccgtaacggtgaagacccggtggcgattcgc
aaagcgctgcaagaatgtatgcagcataacttctcggtattccgcgaaggcgatgcgatg
gcgaaaggtctggaagagctgaaagcgatccgcgaacgcctgaaaaatgcccgtctggac
gatacctccagcgagttcaacacccagcgcgttgagtgtctggagttggataacctgatg
gagaccgcgtacgccactgcagtatctgcaaacttccgtaccgaaagccgtggcgcgcat
agccgcttcgacttcccggaacgtgatgatgaaaactggctgtgccattccctgtacctg
ccagagtcggaatccatgacgcgacgtcaagtcaatatggaaccgaagctgcgcccggca
ttcccgccgaagattcgtacttattaa

DBGET integrated database retrieval system