KEGG   Citrobacter youngae: CD187_18460Help
Entry
CD187_18460       CDS       T05526                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cyo  Citrobacter youngae
Pathway
cyo00473  D-Alanine metabolism
cyo00550  Peptidoglycan biosynthesis
cyo01100  Metabolic pathways
cyo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cyo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CD187_18460
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CD187_18460
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CD187_18460
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cyo01011]
    CD187_18460
Enzymes [BR:cyo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CD187_18460
Peptidoglycan biosynthesis and degradation proteins [BR:cyo01011]
 Precursor biosynthesis
  Amino acid ligase
   CD187_18460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATPgrasp_ST CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 RimK
Motif
Other DBs
NCBI-ProteinID: AWV29239
UniProt: A0A2U9ULQ2
LinkDB All DBs
Position
3740882..3741976
Genome map
AA seq 364 aa AA seqDB search
MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGIDKQGQWHVSDASNYLLN
SNDPAHIALRPSETSLAQVPGKQEHQLIDAQNGQPLPTVDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSDVLGSAACMDKDVTKRLLRDAGLNIAPFITLTRANRNSISFSEVESRLGL
PLFVKPANQGSSVGVSKVTSEAQYDQAVALAFEFDHKVVVEQGIKGREIECAVLGNDHPQ
ASTCGEIVLNSDFYAYDTKYIDDNGAKVVVPAAIAPEINDKIREIAIQAYQTLGCAGMAR
VDVFLTAENDVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIELALERHAADSAL
KTTM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagttgcgggtaggaatcgtatttggtggtaaatcagcggaacatgaagtgtca
ttgcaatcggcaaaaaatattgtcgatgccatcgacaagactcgctttgacgttgtgctg
ttaggtattgataaacaagggcaatggcacgtcagcgatgccagtaactatctgctcaat
tcaaacgatccggcgcatattgcgttgcgaccttctgagaccagcctggcgcaggtaccc
ggtaaacaagagcaccagttgatcgatgcacaaaacggtcaaccgctgccgacggtcgat
gttattttcccgatcgtacacggtactttgggtgaagatggctctctgcagggcatgctg
cgcgtggcgaacctgccgtttgtcggttctgatgtgctgggttctgctgcctgtatggat
aaagacgtgaccaaacgtctgctgcgtgatgccgggttaaacatcgcgccatttattaca
ctcactcgcgcgaatcgcaacagcatcagctttagtgaagtggaatcccgcctgggtctg
ccgctgtttgtaaaaccggccaaccagggatcgtccgttggcgtcagtaaagtaaccagc
gaagcccaatacgatcaggccgtcgcgctggcatttgaattcgatcataaagtcgttgtg
gagcaagggatcaaaggccgcgagatcgaatgtgcggtactgggcaacgatcatccgcag
gccagtacctgtggtgagatcgtgctgaacagcgatttttacgcttacgacactaaatac
attgacgataacggtgccaaagttgtcgttccggcagcaattgcgccagagattaacgat
aagatccgcgaaatcgccattcaggcctaccagactctgggctgtgccggcatggcgcgc
gtggacgtcttcttaactgctgaaaacgacgttgtgatcaatgagatcaacacgctgcct
ggctttaccaacatcagtatgtatccgaaactgtggcaggcgagcggtttaggctatacc
gatttgatcactcgcctgatcgaactggcgctggaacgccatgctgcggatagcgcgctg
aaaaccactatgtaa

DBGET integrated database retrieval system