KEGG   Rippkaea orientalis PCC 8801: PCC8801_0929Help
Entry
PCC8801_0929      CDS       T00806                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K08884  serine/threonine protein kinase, bacterial [EC:2.7.11.1]
Organism
cyp  Rippkaea orientalis PCC 8801
Brite
KEGG Orthology (KO) [BR:cyp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cyp01001]
    PCC8801_0929
Enzymes [BR:cyp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     PCC8801_0929
Protein kinases [BR:cyp01001]
 Serine/threonine kinases: Other
  Bacterial family
   PCC8801_0929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo
Motif
Other DBs
NCBI-ProteinID: ACK65006
UniProt: B7JZR3
LinkDB All DBs
Position
979249..981072
Genome map
AA seq 607 aa AA seqDB search
MKPTALHRSRYRILGQIGQGQFGRVYCAVHRQTGELVALKDLNPQRFPTNRFLREFSYLV
SLRHPNIVSCRAIEHHAKGRYLVMDYCEGGTLRDLMDAQGQLSLGYRLNLITDILLGLEH
AHQHNIIHCDIKPENILLSLTNQGWKARITDFGISRLSQQGAHTGQDGGYTGSPAYMAPE
RSYGQHSYACDLYSVGIIIYELLIGERPFSGLPGDLILAHLNQRVTIPDTVPPSLRTTIE
RALEKLPQRRFASAREMLTDIRHAAEVLELKTPQRVFSPPVLLGESDGVEILGQTPLRDA
VSYLAVEGRLVYLGMWKHLSCAIYRDFNLTGEAIAEKSITLTDPILELNLRPQGCFILTR
ASSRLPVEYNLYCWRPSLNVAGTALEEYQVFPPLQARQVIHAIDVKGRWLALASQSNSKD
RYSQFQLLKLPDLSPINPPVRSPLPPQLLTLDNCHGLALFPYQYHGKQRTYFYFFNRRGL
IIKGFSVPLMLFSLIPLPDSPYQLFGIDANEPDIAIIIKLKPLKVTRIALNFAPKFILPQ
SWGYILANSQGQMMLLDRDGFRMAYVNLSLKITAMVSFGDSKLLVASWSKGKGMLSKLDL
SKVIDNC
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacctactgctttacaccgttctcgctatcgcatcttgggacagataggacaaggg
caatttggtcgcgtttactgtgccgtacaccgccaaacgggagaactggttgcccttaaa
gatcttaatcctcaacggtttcccacgaatcgatttttgcgtgagttttcctacttagtc
agtttgcgccatcccaatatcgtctcttgtcgagcgatcgaacatcatgccaaaggacgc
tatctcgtcatggactactgcgaggggggaactttacgcgacttgatggatgcacaagga
caactcagcttaggatatcgcctgaacctgattaccgatattttattaggtctagaacac
gctcatcaacacaatataattcattgtgacatcaaacccgaaaatattttactcagttta
accaatcaaggctggaaagcacggattaccgattttgggatttctcgtctaagtcagcaa
ggagcacatacaggtcaagatgggggttatacgggatctccggcttatatggctcctgaa
cgctcctacggacagcattcctacgcttgtgatctctattctgtggggattatcatctat
gaattgctgatcggagaacgtcccttttcaggattgccgggggatttaatcctcgctcac
ctcaaccaacgagttactatccccgatactgttccccctagcttacggactaccattgaa
agagccttagaaaaattacctcagagacgctttgcgtctgcacgggagatgttaacagac
atccgtcatgcggcagaggtactcgaactgaaaacgcctcaacgggtgttctccccccct
gtgctcttgggtgaatctgatggggtggaaatcctcggacaaacacccttaagggatgcc
gtcagttatttagcggtggagggaagattagtttatttggggatgtggaaacacttatcc
tgtgccatctatcgagattttaatttaactggggaagcgatcgccgaaaaatccattacg
ttgactgaccccattctggaactgaatttgcgtccccaagggtgttttattctcacccgt
gcctcttctcgtttacccgttgaatataatctttattgttggcggccatccctcaatgtt
gccgggactgctttagaagaatatcaagtttttcctcctctgcaagcgcgtcaagtgatc
catgcgattgatgtcaaaggacgctggttagccttagcttcccagtccaatagtaaggat
cgttatagtcaatttcagttgttaaaattgcccgatttatcacccattaatccccccgtt
cgttctcctttaccgccgcaattattaaccttagataattgtcatgggttggctctgttt
ccttaccaataccacggaaaacagcgaacctatttctatttttttaatcgtcgggggtta
attattaaggggttctcagttcctttgatgttgttttctttaatccctcttcctgactct
ccttatcaactctttgggattgatgctaatgagcctgatatcgctattattattaagtta
aaaccccttaaagtgactcgtattgccttgaattttgcccctaagtttattcttcctcaa
tcttggggatatatcttagccaatagtcagggacaaatgatgttattagatcgagacgga
tttcgtatggcttatgtcaatctatctttgaaaataaccgctatggtcagttttggggat
tctaaattattagtggcgagttggtcaaaaggaaagggaatgttatctaagttggattta
agtaaagtcattgacaattgttaa

DBGET integrated database retrieval system