KEGG   Cyanothece sp. PCC 8801: PCC8801_1231Help
Entry
PCC8801_1231      CDS       T00806                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
cyp00010  Glycolysis / Gluconeogenesis
cyp00020  Citrate cycle (TCA cycle)
cyp00620  Pyruvate metabolism
cyp01100  Metabolic pathways
cyp01110  Biosynthesis of secondary metabolites
cyp01120  Microbial metabolism in diverse environments
cyp01130  Biosynthesis of antibiotics
cyp01200  Carbon metabolism
Module
cyp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC8801_1231
   00020 Citrate cycle (TCA cycle)
    PCC8801_1231
   00620 Pyruvate metabolism
    PCC8801_1231
Enzymes [BR:cyp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PCC8801_1231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase Ribosomal_L18p
Motif
Other DBs
NCBI-ProteinID: ACK65297
UniProt: B7K3F5
LinkDB All DBs
Position
complement(1281559..1282839)
Genome map
AA seq 426 aa AA seqDB search
MIHDIFMPALSSTMTEGKIVSWVKSPGDKVAKGETVVVVESDKADMDVESFYEGYLATIL
VEAGQEAPVGTAIALIAETEAEITQAQQQQKPPSATAEPSRETTSPPVASPQPVPTVTAT
PTVTASNGNGRTVASPRAKKLAKELGVDLKTLRGSGPYGRIVAGDVERATSKVTTVTPTL
TPTPTVQPTPTPSTPPTPVPATPGETVPLTTLQKAVVQNMVATVQVPTYHVGYTITTDAL
DKLYKQLKSKGVTMTALLAKAVAMAVQKHPLVNASYTDQGIKYNGSINVALAVAMDDGGL
ITPVLQNADQVDIYSLSRTWKDLVDRARSKQLQPQEYNSGTITVSNLGMFGVDRFDAILP
PGQGAILAIGASRPQVVATPDGLIGVQRQMAVNITCDHRVIYGAHAAAFLQDLAKVIETD
VQSLTM
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgacatcttcatgcctgcactcagttctaccatgaccgaaggaaaaatcgtc
tcttgggtgaaatctccaggggataaggttgccaaaggggaaacggtggttgttgtcgag
tcagataaagcagatatggacgtagaatcgttctatgaaggctacttagccactatttta
gtcgaagctggccaagaagctcctgttggaacggcgatcgctttaattgcagaaaccgaa
gcagaaattacccaagcgcaacagcaacaaaaacccccctccgctacagcagaaccctcc
cgcgaaacgacatctcctcctgttgcttctccccaacccgtcccgacggttactgcaacc
cctactgttaccgcaagcaatgggaatggacggactgtcgcttccccacgcgcgaaaaaa
ttagccaaagaattaggagttgatctcaaaaccctgcgcggtagcggtccctacggtcgc
attgttgcaggagatgtcgaacgcgcaacaagcaaagtaaccaccgtcaccccaacccta
accccaaccccaacggttcaaccgactcctacccctagtacccctcccactcctgtccct
gcaactcctggggaaacggttcccctaacgacactacaaaaagcggtggttcagaatatg
gtagccactgtccaagtgccgacctatcatgtgggctatactatcaccacagatgcgtta
gataagctctataaacagcttaaatcgaaaggggtgactatgacagccttattagccaaa
gcggttgctatggcagtacaaaaacatcctttagtcaatgccagttatacggatcaaggc
attaaatataatgggtcaattaatgttgctttagctgtggcaatggatgatggaggactc
attacccccgtcttacaaaatgccgatcaagtcgatatttattccctctctcggacatgg
aaagatttagtcgatcgcgccagaagtaagcaattacaaccccaagaatacaacagtgga
accattacggtatcgaatttagggatgtttggggtagaccgttttgatgcgattttaccc
cccggacaaggggcaattttagcgatcggtgcatcccgtccccaagtagtagcaactccc
gatggattaattggagtacaacgtcaaatggcggtaaatattacctgcgatcatcgggtg
atttatggagcccatgcagcggcctttttacaggacttagccaaggtcattgaaaccgat
gttcaatctttaacgatgtaa

DBGET integrated database retrieval system