KEGG   Rippkaea orientalis PCC 8801: PCC8801_1231
Entry
PCC8801_1231      CDS       T00806                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyp  Rippkaea orientalis PCC 8801
Pathway
cyp00010  Glycolysis / Gluconeogenesis
cyp00020  Citrate cycle (TCA cycle)
cyp00620  Pyruvate metabolism
cyp01100  Metabolic pathways
cyp01110  Biosynthesis of secondary metabolites
cyp01120  Microbial metabolism in diverse environments
cyp01200  Carbon metabolism
Module
cyp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC8801_1231
   00020 Citrate cycle (TCA cycle)
    PCC8801_1231
   00620 Pyruvate metabolism
    PCC8801_1231
Enzymes [BR:cyp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PCC8801_1231
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Other DBs
NCBI-ProteinID: ACK65297
UniProt: B7K3F5
LinkDB
Position
complement(1281559..1282839)
AA seq 426 aa
MIHDIFMPALSSTMTEGKIVSWVKSPGDKVAKGETVVVVESDKADMDVESFYEGYLATIL
VEAGQEAPVGTAIALIAETEAEITQAQQQQKPPSATAEPSRETTSPPVASPQPVPTVTAT
PTVTASNGNGRTVASPRAKKLAKELGVDLKTLRGSGPYGRIVAGDVERATSKVTTVTPTL
TPTPTVQPTPTPSTPPTPVPATPGETVPLTTLQKAVVQNMVATVQVPTYHVGYTITTDAL
DKLYKQLKSKGVTMTALLAKAVAMAVQKHPLVNASYTDQGIKYNGSINVALAVAMDDGGL
ITPVLQNADQVDIYSLSRTWKDLVDRARSKQLQPQEYNSGTITVSNLGMFGVDRFDAILP
PGQGAILAIGASRPQVVATPDGLIGVQRQMAVNITCDHRVIYGAHAAAFLQDLAKVIETD
VQSLTM
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgattcacgacatcttcatgcctgcactcagttctaccatgaccgaaggaaaaatcgtc
tcttgggtgaaatctccaggggataaggttgccaaaggggaaacggtggttgttgtcgag
tcagataaagcagatatggacgtagaatcgttctatgaaggctacttagccactatttta
gtcgaagctggccaagaagctcctgttggaacggcgatcgctttaattgcagaaaccgaa
gcagaaattacccaagcgcaacagcaacaaaaacccccctccgctacagcagaaccctcc
cgcgaaacgacatctcctcctgttgcttctccccaacccgtcccgacggttactgcaacc
cctactgttaccgcaagcaatgggaatggacggactgtcgcttccccacgcgcgaaaaaa
ttagccaaagaattaggagttgatctcaaaaccctgcgcggtagcggtccctacggtcgc
attgttgcaggagatgtcgaacgcgcaacaagcaaagtaaccaccgtcaccccaacccta
accccaaccccaacggttcaaccgactcctacccctagtacccctcccactcctgtccct
gcaactcctggggaaacggttcccctaacgacactacaaaaagcggtggttcagaatatg
gtagccactgtccaagtgccgacctatcatgtgggctatactatcaccacagatgcgtta
gataagctctataaacagcttaaatcgaaaggggtgactatgacagccttattagccaaa
gcggttgctatggcagtacaaaaacatcctttagtcaatgccagttatacggatcaaggc
attaaatataatgggtcaattaatgttgctttagctgtggcaatggatgatggaggactc
attacccccgtcttacaaaatgccgatcaagtcgatatttattccctctctcggacatgg
aaagatttagtcgatcgcgccagaagtaagcaattacaaccccaagaatacaacagtgga
accattacggtatcgaatttagggatgtttggggtagaccgttttgatgcgattttaccc
cccggacaaggggcaattttagcgatcggtgcatcccgtccccaagtagtagcaactccc
gatggattaattggagtacaacgtcaaatggcggtaaatattacctgcgatcatcgggtg
atttatggagcccatgcagcggcctttttacaggacttagccaaggtcattgaaaccgat
gttcaatctttaacgatgtaa

DBGET integrated database retrieval system