KEGG   Rippkaea orientalis PCC 8801: PCC8801_2246Help
Entry
PCC8801_2246      CDS       T00806                                 

Definition
(GenBank) ABC transporter related
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
cyp  Rippkaea orientalis PCC 8801
Brite
KEGG Orthology (KO) [BR:cyp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cyp02000]
    PCC8801_2246
Transporters [BR:cyp02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    PCC8801_2246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 DUF4162 AAA_16 AAA_23 AAA_15 RsgA_GTPase AAA_28 ATPase_2 AAA_29 AAA_22 AAA_33 AAA_13 TsaE cobW AAA_30 AAA_18 AAA AAA_24 Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: ACK66269
UniProt: B7K174
LinkDB All DBs
Position
2317296..2318246
Genome map
AA seq 316 aa AA seqDB search
METELAIATNRLTKQFDRYVAVNQVELQVEIGEVYGLIGPNGAGKTTLIRMLSAAEEPTT
GEIYLYGDRLLRNNSNPHLKQRLGYLPDDFPLYEDLNVWDYLEYFARLYYLKSPHRRRRL
QEVLELVQLTSKRDSKINTLSRGMKQRLSLARTIIHEPMLLFLDEPVSGLDPIARMQFRE
IIKVLQTAGMTILISSHVLSDLAQLCTSVGIMELGSLVESTSLTELYQRLSLQQIIITTL
GNLEDLKRELKHHPKVEEWEVIPEKNSLRVNFSGGDEESADLLRSLIHQGLPIREFHCTQ
EDLETIFLKLGHKQVS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagaactagcgatcgccactaatagactaaccaaacaatttgaccgttatgtg
gctgttaatcaagtagaattacaagtagaaataggagaagtatacggattaatcggtccc
aatggagccggaaaaacaactctaattcggatgttatctgctgcggaagaaccgacaacg
ggagaaatttatctgtatggcgatcgcttattacgcaataatagtaatccccatctcaaa
caacgattaggctatcttcctgatgactttcccctctatgaagatttgaatgtttgggat
tatttagagtattttgctcgactttattatctcaagtctccccatcgtcgtcgtcgtctt
caagaggttcttgaattagttcaattaaccagtaaacgagatagtaaaattaatacctta
tcacggggaatgaaacagcgtttaagtcttgctagaacgattattcatgaaccaatgtta
ttatttcttgatgaacctgtatccggacttgatcccattgctagaatgcagtttagagag
attattaaagtcttacaaacagccggaatgacgattttaatttcttcccatgtcctcagt
gatttagctcaattatgtacctccgttgggattatggaattaggatctttagtagaaagt
acctccttaactgagctttatcaacgattatctttgcaacaaattattattactacttta
ggcaatttagaagacttaaaaagggaattaaaacaccatcctaaagtagaagaatgggaa
gttatcccagaaaaaaatagtctcagggtgaatttttcaggaggagatgaagaaagtgca
gatttattgcgatcgctaattcatcaaggtcttcctattcgagaatttcactgtactcaa
gaagatttagaaaccatttttctgaaattgggacataaacaagtctcataa

DBGET integrated database retrieval system