KEGG   Rippkaea orientalis PCC 8801: PCC8801_3354Help
Entry
PCC8801_3354      CDS       T00806                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cyp  Rippkaea orientalis PCC 8801
Pathway
cyp00473  D-Alanine metabolism
cyp00550  Peptidoglycan biosynthesis
cyp01100  Metabolic pathways
cyp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cyp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PCC8801_3354
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PCC8801_3354
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PCC8801_3354
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cyp01011]
    PCC8801_3354
Enzymes [BR:cyp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PCC8801_3354
Peptidoglycan biosynthesis and degradation proteins [BR:cyp01011]
 Precursor biosynthesis
  Amino acid ligase
   PCC8801_3354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ACK67323
UniProt: B7JZB2
LinkDB All DBs
Position
complement(3503598..3504653)
Genome map
AA seq 351 aa AA seqDB search
MAKLRVGLLFGGRSGEHEVSLNSAKAIATALQSGENPQKYDIIPIYIQKNGVWQAGDTAQ
QVLNDAKPLPCEDATSQQLWTFPPQVSEVDVWFPILHGPNGEDGTLQGLLTLMQTPFVGS
GVLGSAVGMDKIAMKMAFAQAGLPQVKYIAVDRAQIWSNPCVFPKLCDEIEQRLGYPCFV
KPANLGSSVGIAKVRSRSELEKALDSAASYDRRIVIETGVKAREVECAVLGNENPKASVI
GEITYNSDFYDYEAKYTDGMAQMHIPAQLPDAIVTQIQDMAIQAFKAVDGAGLARVDFFY
VEDSQEVFINEINTLPGFTAFSMYPQLWKETGVPFAELVDQLIQLALERKQ
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattacgggtagggttactgttcgggggacgttcgggagaacacgaggtgtct
cttaattctgctaaagcgatcgcaacggctttacaatcgggtgaaaatccccaaaaatat
gatataataccgatttatatccaaaaaaacggcgtttggcaagctggagacaccgcgcaa
caagtcctcaacgatgcaaaacctttaccttgtgaggatgcaacctcgcaacaactctgg
acatttcccccccaagttagtgaggtggatgtttggtttcccattcttcacggtcccaat
ggagaagatggaactttgcaagggttattaaccctaatgcagactccctttgtgggcagt
ggtgtgttaggatcagccgtaggcatggataagattgccatgaaaatggcctttgctcag
gcaggattacctcaagttaagtatatcgcggtagatagagcccaaatttggtctaatccc
tgcgtttttcccaagctttgcgatgagattgaacaacggttaggctatccgtgttttgtt
aaacccgctaacttaggatcatcggtgggaattgccaaagtgcgatcgcgttctgaatta
gaaaaggccttagatagtgcagcgagttacgatagacgcattgttatcgaaacaggagtc
aaagcgcgagaggtagaatgtgctgttttaggcaatgaaaacccgaaagcgtcggttatt
ggcgaaattacctacaatagtgatttctatgactacgaggcaaaatataccgatgggatg
gctcaaatgcacattcccgcgcaattgcctgatgcgattgtaacccaaattcaagacatg
gctatccaagcgtttaaggcggtagacggggcaggattagctagggtagactttttctat
gtcgaagatagccaagaagtgtttatcaatgaaattaatacccttccagggttcactgcg
tttagtatgtatccccaactttggaaagaaacgggggttccttttgcggaattggttgat
caattaattcaattagcgttagaaagaaaacaatag

DBGET integrated database retrieval system