KEGG   Cycloclasticus sp. P1: Q91_0051Help
Entry
Q91_0051          CDS       T02265                                 

Definition
(GenBank) Multimodular transpeptidase-transglycosylase PBP 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq00550  Peptidoglycan biosynthesis
cyq01100  Metabolic pathways
cyq01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cyq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Q91_0051
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Q91_0051
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cyq01003]
    Q91_0051
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cyq01011]
    Q91_0051
Enzymes [BR:cyq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Q91_0051
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Q91_0051
Glycosyltransferases [BR:cyq01003]
 Polysaccharide
  Bacterial polysaccharide
   Q91_0051
Peptidoglycan biosynthesis and degradation proteins [BR:cyq01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Q91_0051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AFT66092
UniProt: K0C309
LinkDB All DBs
Position
complement(51185..53506)
Genome map
AA seq 773 aa AA seqDB search
MSIYSRDGLLIAKFGEKKRIPTRYEDIPATQINAFLAAEDKDFFQHSGVDFIGLLRATGQ
LLLTGEKKQGGSTITMQVARNFFLTKKKTYSRKIREILLSFIIERELSKQDILTLYLNKI
YLGHRSYGIAAAAQVYYDSTLSDLSLAQQAMIAGLPKAPSAFNPISNPDRALLRRNYVLN
RLLSLNYISQPEFNAAIAEPITARLHSASVELEAPYVAEMVRNEVYEIYGDEIYTNGMHV
VTTLDSTHQNAANHAVRKALHAYDRRHGYRGILDHIDLDNIDTNDLDLSPLSSYKKIGET
EPAIVTALTDKSVTAITSDKVLVEITWENLKWAWPYINENKQGKKPTSAAEILAVGDIIR
VRQQPNTDIFELAQVPNVSGALVSINPNDGALTSLVGGYDYYSSKFNRAFQSQRQPGSGF
KPILYSAALSKGYTTATLINDAPVVFDDAGLEQQWRPENYSGKFFGPTRLREALIHSRNL
VSIRILRDIGTKYVRNFAGRFGFNPSSLPNNLSLSLGSGSANPYKMATAYSVFANGGFSV
SPYFIQQITSASGEILFQANPAVAIIDKQETPQSKNLLADSAVTTPLITPTLLDNNTPID
PIVEPPIRKAPRVISPQLHFLINSLLRDVVNRGTGRKALSLGRSDLAGKTGTTNDQRDAW
FNGFNPSLVAVAWVGLDNGKPLGNRETGGRAALPIWIDFMREALKNTPNIPLSQPDGIVG
LLIDSETGLKTNPSNPKAIFEYFREENTPPADNKNNEFSNSSLGKQPSIEELF
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgagcatctacagccgagacggcttactcattgctaaatttggtgaaaaaaaacgcatt
cctacacgttacgaagacattccagcgacccaaatcaatgcctttcttgccgctgaagat
aaagacttctttcaacactcaggtgtcgattttattgggcttctgcgtgccacaggccag
cttctattaactggcgagaagaaacaaggaggcagcaccattaccatgcaggtcgccaga
aatttctttctcacgaagaaaaaaacgtattcgagaaaaatacgtgaaatcctcttatct
tttattattgaaagagagctaagcaaacaagacattctaacgctttatctaaataaaatt
taccttggccatcgctcgtacggtatagcagcagccgctcaagtgtattatgactcaaca
ctttcagatctctctttagcccagcaagcaatgattgctggacttccaaaggcaccttcc
gccttcaacccaatctccaacccagacagagcgctccttcgccgtaactatgttcttaac
cgattactaagtcttaactacattagtcaaccggagtttaatgccgccattgccgaaccc
attaccgctcgcttacattctgcttctgtggaacttgaagcaccttatgttgcagaaatg
gtgcgcaatgaagtttatgaaatatatggtgatgaaatttataccaacggcatgcatgtt
gtcaccactctcgacagcactcaccaaaatgctgccaatcatgccgttagaaaggcctta
cacgcctatgatcggcgccacgggtatcgcggtattttagaccatattgacttagataat
atcgacaccaacgacttagatttaagtcctttatcatcgtataaaaaaattggtgaaaca
gaacccgccattgtgaccgctttaacggacaagagcgttactgccatcacctcagataaa
gtactagtcgaaattacttgggaaaacctgaaatgggcatggccatatatcaacgaaaat
aagcaagggaaaaagccaacctcagccgctgaaattttggctgttggtgatattatccgg
gttcgtcagcaacctaatactgatatttttgagcttgcccaagtgcctaacgtttctggc
gcgctcgtttcaattaacccaaacgatggtgctctcacttctcttgttgggggctatgat
tattactccagtaaatttaaccgtgcctttcaatctcaacgccaaccggggtctggcttc
aaacctattttatactccgctgccctatctaaaggctatacaacggctacgttgattaat
gatgctcctgtcgtttttgatgatgcaggcctcgaacagcaatggcgaccagaaaattat
agcggcaagttctttggccctacccgtttacgtgaagcgcttattcactcaagaaaccta
gtctcaataagaattctacgggacatcggcacaaaatatgtacgaaactttgccggacgt
tttggctttaacccctcctcactaccaaacaacctctccttgtcccttggtagcggtagc
gctaacccatacaaaatggcaaccgcttattctgtctttgctaatggcggcttcagtgta
agcccttattttatccaacaaattacttctgcctctggcgaaatactcttccaagctaat
ccagctgtcgccatcatcgacaagcaagaaacgccacaaagcaaaaatctacttgccgac
tcagcagtgacaacgccgctaataacgcctacgctattagataacaacacacccattgac
cccatcgttgaacctcctattagaaaagctcctcgtgttatttccccacaacttcacttt
cttattaattctttattaagggatgttgtcaaccgaggaaccgggagaaaagccctttct
ttaggtcgctcagacctagcaggtaaaacgggcacgaccaatgatcaaagggatgcttgg
ttcaatggattcaacccttcattggttgccgttgcttgggttggccttgataacggcaaa
ccattaggcaatagagaaacaggtggccgcgccgccttacctatttggattgactttatg
agggaggcacttaaaaacacacctaatatccccctctcacagcccgatggcattgttgga
ttattaattgactctgagacagggttaaaaacaaacccttcaaacccaaaagctattttt
gaatatttccgagaagaaaatacaccgccagctgataataaaaataatgaattcagtaac
tcgtccctaggaaaacaaccctccatcgaagagttattctaa

DBGET integrated database retrieval system