KEGG   Cycloclasticus sp. P1: Q91_0057Help
Entry
Q91_0057          CDS       T02265                                 

Gene name
aroK
Definition
(GenBank) Shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cyq01100  Metabolic pathways
cyq01110  Biosynthesis of secondary metabolites
cyq01130  Biosynthesis of antibiotics
cyq01230  Biosynthesis of amino acids
Module
cyq_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cyq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Q91_0057 (aroK)
Enzymes [BR:cyq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Q91_0057 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin dNK Cytidylate_kin2 AAA_33 APS_kinase AAA_16 ABC_tran AAA AAA_22 AAA_PrkA RuvB_N RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AFT66098
UniProt: K0C0S5
LinkDB All DBs
Position
58983..59501
Genome map
AA seq 172 aa AA seqDB search
MPEKNNIYLVGPMAAGKSTIGKLLARRLNKAFYDTDAEIIKCTGVEISLIFELEGEEGFR
SRETDKLKLLSVLDGAVIATGGGIVLSEENRKVLTETGWVIYLQCSVEQQLSRTKFDTKR
PLLQIDNPRKKLEELMRLRAPIYESIADIVVSTNKTSSKKVILSILEQLKKK
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaaaaaataatatctatcttgtgggcccaatggcagccggcaaatcaacgatt
ggtaaactgttagcgcggcgtttgaataaagcattttatgatacagatgcagaaattatt
aaatgtacaggggtagaaatatccttaatttttgagcttgaaggggaagaaggttttagg
tctagagaaaccgataaacttaagttactgtcggtattggatggcgctgtcattgcaaca
ggtggtggtattgtcttaagcgaagaaaatcgtaaagtgttaacggaaacaggctgggtt
atatacttacaatgctctgttgagcagcagttaagccgaacaaaatttgatacaaaaagg
cctttattgcaaattgacaacccacggaagaagctggaagaattaatgcgacttagagcg
ccgatttatgaatcaattgcagacatcgttgttagcacaaacaaaacaagtagtaagaaa
gtaatcttaagtattcttgagcaactaaagaaaaaatga

DBGET integrated database retrieval system