KEGG   Cycloclasticus sp. P1: Q91_0962Help
Entry
Q91_0962          CDS       T02265                                 

Definition
(GenBank) Transcriptional regulator, TetR family
  KO
K23777  TetR/AcrR family transcriptional regulator, regulator of cefoperazone and chloramphenicol sensitivity
Organism
cyq  Cycloclasticus sp. P1
Brite
KEGG Orthology (KO) [BR:cyq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cyq03000]
    Q91_0962
Transcription factors [BR:cyq03000]
 Prokaryotic type
  Helix-turn-helix
   TetR/AcrR family
    Q91_0962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N MRC1
Motif
Other DBs
NCBI-ProteinID: AFT67000
UniProt: K0C388
LinkDB All DBs
Position
1018653..1019249
Genome map
AA seq 198 aa AA seqDB search
MKLSKGLDKKNKIFDVALTLFSKYGFKAVTMREIAAKSSTSLGSLYIHYKSKAELYDMVL
DSAYLEHAKAWRVTSDPDETLESKLYRFINNFCHFMNDNVEVAKLFKREQLDADPKRIKK
LAEKVLSEEYNNLKELVIEANPTCHADVTTVLIFGMALNYYETMEFRKYFPGYDDSINSP
DFIAEQIFNMAIAGLKST
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatcgaaaggattggataagaaaaataaaatatttgatgttgcgttaacgcta
ttttcaaaatatggctttaaggcagttactatgagagagatagctgctaaatcatcgacc
agtctcggttccttatatattcactataaatcaaaggcagagttatatgacatggtttta
gatagtgcttaccttgagcacgctaaagcatggcgagtaacctctgatcctgatgaaact
ttagaaagtaaactgtaccgatttataaataacttttgccactttatgaatgataacgtt
gaagtggcgaagctttttaaacgtgaacaactggatgctgatcctaagcgtattaagaag
cttgcagagaaggtattatccgaagaatataataatttaaaagagctagtgatagaggct
aaccctacatgtcatgcagatgtcacgacggttttgatttttggtatggcactaaattat
tatgaaacgatggaatttagaaaatactttcctggttatgatgattccatcaatagtcca
gattttattgcagagcaaatatttaatatggcaatagcggggcttaaaagtacgtaa

DBGET integrated database retrieval system