KEGG   Cycloclasticus sp. P1: Q91_0964Help
Entry
Q91_0964          CDS       T02265                                 

Gene name
andAc
Definition
(GenBank) Ring hydroxylating dioxygenase, alpha subunit/Rieske (2Fe-2S) protein
  KO
K16319  anthranilate 1,2-dioxygenase large subunit [EC:1.14.12.1]
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq00627  Aminobenzoate degradation
cyq01100  Metabolic pathways
cyq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cyq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Q91_0964 (andAc)
Enzymes [BR:cyq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     Q91_0964 (andAc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske Ring_hydroxyl_A Aromatic_hydrox
Motif
Other DBs
NCBI-ProteinID: AFT67002
UniProt: K0C5M7
LinkDB All DBs
Position
1020886..1022151
Genome map
AA seq 421 aa AA seqDB search
MMRVNKVNEKNKVINSLDWSDSTKIPFEVYTDESIYKLEQENIFRGETWSFVALESELAE
AFSYKSTFVGDVPVVATRDDKDNFYVWVNRCSHRGAEVCRERHGKSEDGVFTCVYHQWAF
DASGECVGVPFRKGHGGKGGFPKDFKPSDRPLQKLKVERLGGLIFASFADQGPTLEEYLG
PQMLKMMLRVLCKPIEYLGVTRQYVNANWKLYTENTKDPYHASLLHLFHATFGVYRSTMG
GGAEIGGPLNMHSLLSAYVIENEDKSEYEKGDLRTYDTGVKLADTSVLEVTPELDPVFTN
HIQSIFPSMVLQQIHNTLAVRQIIPKGVDEFELVFHFFGYEDDTPELRAERVRQMNLVGP
AGYISMEDGEATELVQNAIKGDPSHHSLMAMGEDGDEGTLLTESILRAYWKGYQQIMGVT
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgatgagggtgaataaagtgaatgaaaaaaataaagtaattaatagcttggattggagt
gactcaacaaaaattccatttgaagtttatacagacgaaagtatttataagcttgaacaa
gaaaatatttttcgtggtgaaacctggagtttcgttgcgctggaatctgaattagcagaa
gcatttagttataagtcgacatttgtaggtgatgtgcctgttgtcgcaacccgtgatgat
aaagataacttctatgtatgggttaaccgctgttctcatagaggtgcagaagtttgtaga
gaacgacatgggaagtctgaagatggcgtttttacttgcgtttaccaccagtgggccttt
gatgcgtcaggcgagtgtgttggggttccttttcgtaaaggccatggtggaaaaggtggt
tttcctaaggactttaagccgagtgaccgacctttacaaaagttaaaagttgaaagattg
ggtgggcttatttttgcaagttttgctgatcaagggccaacattagaggaatacctaggc
cctcaaatgctcaaaatgatgttgagggtgttatgtaagccgatcgaatacctcggcgtg
actcggcaatatgttaatgctaattggaagctatatacagagaacactaaagacccttat
cacgccagtttactgcatctttttcatgccacgtttggtgtttaccgatctacgatgggt
ggtggtgctgaaataggtgggccgttaaatatgcatagccttcttagcgcctatgttatt
gaaaatgaagataaatctgagtacgaaaaaggtgatttaagaacctatgatacaggtgtt
aagttagctgatacctctgttttagaagttacaccagaattagacccagtttttaccaat
catatccaatctattttcccttcaatggtgttacagcaaattcataacaccttggcggta
cgtcaaattattcctaaaggtgtcgacgaatttgagttggtgttccatttttttggctat
gaagatgatacccctgaattaagagctgaaagagttaggcagatgaacttagtaggccca
gcgggttatatctctatggaagatggtgaagccactgaattggttcaaaacgccattaag
ggtgatccaagtcatcattcattgatggcaatgggtgaagacggagatgaaggtacgttg
ttaaccgagtcgatattacgtgcctattggaaaggttatcagcaaattatgggtgtgact
cagtaa

DBGET integrated database retrieval system