KEGG   Cycloclasticus sp. P1: Q91_0965Help
Entry
Q91_0965          CDS       T02265                                 

Definition
(GenBank) Alpha/beta hydrolase fold protein
  KO
K15756  2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoate hydrolase [EC:3.7.1.13]
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq00621  Dioxin degradation
cyq01100  Metabolic pathways
cyq01120  Microbial metabolism in diverse environments
cyq01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cyq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    Q91_0965
Enzymes [BR:cyq01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.13  2-hydroxy-6-oxo-6-(2-aminophenyl)hexa-2,4-dienoate hydrolase
     Q91_0965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Abhydrolase_5 Esterase Abhydrolase_4 FSH1
Motif
Other DBs
NCBI-ProteinID: AFT67003
UniProt: K0C379
LinkDB All DBs
Position
1022186..1023010
Genome map
AA seq 274 aa AA seqDB search
MNEADFETKYIDVNGVKTCYIEEGQGEPVILIHGGGAGANSYGNWFASLPLFGKKFRAIA
IDMIGFGKSEGPAVIGADCSQKTRYDHLAGFIKAMGFEKATLVGNSMGGATAMGVAIEYP
ELVDKLVLMGSAGLNTEISEALMPILKYDFTKEGMVKMVQALTNDDFVITDEMIDYRFAN
SIDPSNKEAYGNVMEWIKSQGGLFYEDEYIAKITQKTLVVNGKNDLVVPLTHAHKFLELI
NDSWGYIVPHCGHWAMIEHPEDFASAVSQFIESH
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagcagattttgaaacaaaatatattgatgttaacggtgttaaaacttgttat
atagaagaagggcaaggtgagccggtcattttaattcatggtggtggagcaggtgccaat
agctacggtaactggtttgcaagcctgcctcttttcggtaagaagtttagagcgattgcc
atcgatatgattggctttggtaaatctgaaggccctgctgtcattggagcggactgctca
caaaaaacccgctatgaccatttagctggctttattaaagccatggggtttgaaaaagca
acattggttggaaactctatgggtggcgcaacggctatgggtgttgccattgagtaccca
gagcttgttgataaattggtgttgatgggaagtgctggtctcaatacagaaatctcagaa
gcattgatgccgatcttgaaatatgacttcactaaagaaggtatggtgaaaatggttcaa
gcgttaaccaatgatgattttgttattactgatgagatgatcgattaccgttttgccaac
tctatagacccgagtaataaagaagcttatggcaatgtgatggagtggattaaatctcag
ggagggcttttttacgaggatgaatacattgcgaaaatcacccagaaaacattagttgta
aatggcaaaaatgatctggttgttcccttaactcacgcgcacaaatttttagaattaatt
aatgattcatggggttatatagtccctcattgtggtcattgggcgatgattgagcatcca
gaagattttgcatcagcggttagccaatttattgaatctcactaa

DBGET integrated database retrieval system