KEGG   Cycloclasticus sp. P1: Q91_1064Help
Entry
Q91_1064          CDS       T02265                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase subunit A
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq00020  Citrate cycle (TCA cycle)
cyq00190  Oxidative phosphorylation
cyq00650  Butanoate metabolism
cyq01100  Metabolic pathways
cyq01110  Biosynthesis of secondary metabolites
cyq01120  Microbial metabolism in diverse environments
cyq01130  Biosynthesis of antibiotics
cyq01200  Carbon metabolism
Module
cyq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cyq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cyq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cyq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Q91_1064 (sdhA)
   00650 Butanoate metabolism
    Q91_1064 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Q91_1064 (sdhA)
Enzymes [BR:cyq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Q91_1064 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     Q91_1064 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AFT67102
UniProt: K0C5Y2
LinkDB All DBs
Position
1125916..1127709
Genome map
AA seq 597 aa AA seqDB search
MSIEDYKITEHKYDVVVVGAGGAGLRATFGMAQKGLKTACITKVFPTRSHTVAAQGGISA
ALGNMGKDDWRWHMYDTVKGSDWLGDQDAIEYMCREAIPAIVELEHYGVPFSRTEEGKIY
QRPFGGMTTNYGEGTAQRTCAAADRTGHAILHTLYQQSLKHDAEFFIEYFALDLIMDDDG
VCRGVLALKMDDGTLHLFRSHMAVMATGGYGRSYFSCTSAHTCTGDGNAMALRAGLPLQD
MEFVQFHPTGIYGSGCLITEGVRGEGGYLTNSKGERFMERYAPNAKDLASRDVVSRSMTI
EINEGRGVGPDGDHINLHLEHLGPEVIEERLPGIAESAKIFAGVDVSKEPIPVLPTVHYN
MGGIPTNYKGEVVTLDGDNPDKVVEGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRSAA
IRAAEVVKPGTDHPDLAKTACDKALTRLDKFRNANGSKRTSEVRLDMQRTMQKHAAVFRT
GESMQEGVEKLREVQESFKDVSISDRSLIWNTDLIETLELDNLLSQAAVTIEGALNREES
RGGHAREDFPDRDDDKWHKHSIMWFDDQNKVSIKFRPVHMYTLSDDVDVVPPKKRVY
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgagtattgaagattataaaataaccgaacacaagtacgatgttgtggtggtcggtgct
ggcggtgctggtttacgtgcaacctttgggatggcgcaaaaaggcttaaaaacagcgtgt
attactaaagtttttcctacgcgtagtcatactgttgctgcacaaggtggtattagtgca
gcgttaggtaatatgggtaaagatgattggcgctggcatatgtatgacaccgtcaaaggg
tctgattggttgggtgaccaagatgctattgagtatatgtgtcgtgaagcgattcctgca
attgttgagcttgaacattatggtgtgccattttctcgtacagaagaaggcaaaatctat
cagcgtcctttcggtgggatgaccactaattatggtgaagggactgcacaacgtacttgt
gcagcggctgaccgaacaggccatgcaatccttcatacgctatatcaacaatctttaaaa
catgatgcagagttcttcattgagtactttgcgcttgatttaattatggatgacgacggt
gtatgtcgtggtgtattagcacttaaaatggacgacggtacgcttcatctgttccgttca
cacatggctgtcatggcaaccggtgggtacgggcgttcatacttctcttgcacctctgcc
cacacctgcactggtgatggtaatgctatggcgttaagagctggcttgcctctacaagat
atggaatttgttcaattccatcccacaggtatatacggctcaggttgtttgattactgaa
ggtgtgcgtggtgaaggtggctatttaactaattctaagggtgagcgctttatggagcgt
tatgcgccgaacgctaaagatttagcctctcgcgatgtagtgagtcgctccatgacgatt
gaaattaatgaagggcgtggcgttggtccagatggggatcatattaaccttcatctggaa
cacttaggtcctgaagttattgaagagcgtttaccgggtattgccgaaagtgcaaaaata
tttgcaggtgtagatgtcagcaaggaacctattcctgttctaccaaccgtgcattacaac
atgggtggtattccaaccaattataaaggtgaagttgttactcttgatggcgataaccca
gataaagttgtagaagggttgatggctattggtgaggctgcttgtgtgtctgttcatggt
gcgaatagattagggtcaaactcactattagatttagtagtgtttggtcgttctgcagct
attagagccgctgaagtggttaaacctggtacggatcatccagacttggcaaaaactgcc
tgcgataaagcattaactcgcctagataagtttagaaatgcaaatggttctaaaagaacc
tcagaagttcgcctagatatgcaaagaaccatgcaaaaacatgcggctgtgtttcgaaca
ggtgagtctatgcaagaaggtgttgaaaaacttagagaagttcaagaatcatttaaagac
gtgtcgatctctgatcgttcactaatttggaacactgatttaatagaaacactggaactt
gataacttattgtctcaagcagcggtaacgattgaaggtgctttaaatagagaagaaagc
cgtggtggtcacgcacgtgaggatttcccagatcgtgatgatgataaatggcataagcat
tcaattatgtggtttgacgatcaaaataaggtcagcattaagttccgccctgtacatatg
tatacattgtcggatgatgtggatgttgttccgcctaaaaagcgtgtctactaa

DBGET integrated database retrieval system