KEGG   Cycloclasticus sp. P1: Q91_1065Help
Entry
Q91_1065          CDS       T02265                                 

Gene name
sdhB
Definition
(GenBank) Succinate dehydrogenase, iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq00020  Citrate cycle (TCA cycle)
cyq00190  Oxidative phosphorylation
cyq00650  Butanoate metabolism
cyq01100  Metabolic pathways
cyq01110  Biosynthesis of secondary metabolites
cyq01120  Microbial metabolism in diverse environments
cyq01130  Biosynthesis of antibiotics
cyq01200  Carbon metabolism
Module
cyq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cyq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cyq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cyq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Q91_1065 (sdhB)
   00650 Butanoate metabolism
    Q91_1065 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Q91_1065 (sdhB)
Enzymes [BR:cyq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Q91_1065 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     Q91_1065 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_9 Fer2 Fer4_7
Motif
Other DBs
NCBI-ProteinID: AFT67103
UniProt: K0C3I0
LinkDB All DBs
Position
1127730..1128515
Genome map
AA seq 261 aa AA seqDB search
MAEFTLPKNSVVQEGKTYPAPEGATNIQAVEIYRWDPDSGENPRVDKYFLDLDTCGPMVL
DAIIKIKDEVDSTLTFRRSCREGICGSCSMNINGRNTLACTKDIGDIDGPIKIYPLPHMP
VVKDIVPDLTHFYAQYASIKPWIQSTTPPPPDKERLQSKEDRAQLDGLYECILCACCSTS
CPSYWWNGDRYLGPAILLQAYRWLADSRDENAGERLDELEDPFKLYRCHTIMNCTETCPK
GLNPAKAIAEIKKLLVERKIA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatttacacttccaaaaaactctgtagtacaagagggtaaaacttaccctgca
cctgaaggtgctaccaatattcaagcagttgaaatttatcgttgggacccagatagcggt
gaaaacccacgcgttgataaatactttcttgacctagatacttgtggcccaatggtattg
gatgccattatcaaaattaaagatgaggttgattcaacattaacttttcgccgttcttgc
cgtgaaggaatttgtggctcttgttcgatgaatattaatggtagaaataccttagcctgt
accaaagatattggtgatattgatgggcctattaagatttacccattaccgcatatgccc
gttgtaaaagacattgtgcctgacctaacgcacttctatgctcaatacgcctctatcaaa
ccttggattcaatcaacaacaccacctccacctgataaagagcggctacagtcaaaagaa
gaccgcgcacaacttgatggtttatatgaatgtattctttgtgcatgctgttcaacatca
tgcccaagttactggtggaatggtgatcgctacctaggtccagcaatcttgctgcaagct
tatcgttggttagctgattcgcgtgacgaaaatgcaggtgagcgtttggacgagcttgaa
gatcctttcaaattgtatcgttgccataccattatgaattgcactgaaacctgcccgaaa
ggtttgaatccagcaaaagccatcgctgagattaaaaaactattagttgaacgaaagatt
gcttaa

DBGET integrated database retrieval system