KEGG   Cycloclasticus sp. P1: Q91_1360Help
Entry
Q91_1360          CDS       T02265                                 

Definition
(GenBank) bacterial motility regulatory-like protein MotR
  KO
K04562  flagellar biosynthesis protein FlhG
Organism
cyq  Cycloclasticus sp. P1
Brite
Bacterial motility proteins [BR:cyq02035]
 Flagellar system
  Flagellar assembly proteins
   Regulation
    Q91_1360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ParA AAA_31 CbiA CBP_BcsQ MipZ Fer4_NifH ArsA_ATPase AAA_24 VirC1 ArgK ING CorA VAPB_antitox AAA_25 TMF_TATA_bd Prefoldin_2 HR1
Motif
Other DBs
NCBI-ProteinID: AFT67397
UniProt: K0C6T4
LinkDB All DBs
Position
1439450..1441063
Genome map
AA seq 537 aa AA seqDB search
MELAYTNTSINSMSQPKAKVITVTSGKGGVGKSSTATNLALSLTALDKKVCVFDADASLA
NINILLGIQPTYTLQHLLNGEKNLKEIIIDGPRGLKVVPGATGIAEYAQLTNEQKLILLA
ALDKLQQDFDYLIIDTAAGIGDDVLDFIRASQFSIIIITPEPTSLTDSFSLLKVLKRSNY
NRTSYILVNMALDAENSQAIYKRFESAVKKYIDVDINYLGYIQVDETMISSIRLQCPAVL
LSPDSNASGCFKKLAQELDKEVAEQTVDSFSEFWRQQDGIDSRAQTPSETPVVTFKEDTL
PNTVTPPASVKTPLSFKQAADFCIAQLSTGDVTEEDSAAFLEQLTQFQPQVPEEPTTQAD
QAPSSSSIRELYNYLEQRSFPKDELREIVTTLEQVYFEKHAESLNSFESSSLKLFAQFSG
NEDDLHYLNQQLSSCFQREFKKPLYDVLEHLESLVSSNNFSQQSFDDLLSELLSSYQKKF
NEAYKTMADENLKSAREEISVLQKQLSDINNELNDTNNTLTEKIMLLNKIQALLPSS
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggaattagcttacactaacacaagtataaacagtatgagccagccaaaagcaaaagtt
atcacagtcaccagtggtaaagggggcgttggtaagtctagcacggccactaatctagcg
ctttctcttaccgcgttagacaaaaaagtgtgtgtatttgatgctgatgctagtttggcc
aacattaatattctattaggtattcaaccaacgtataccttacaacatcttttaaacggc
gaaaaaaacttaaaagaaattattattgatgggccacgcggcttaaaagttgttcccggc
gcgaccggaattgctgaatatgcgcaattaacaaatgagcaaaaactgatcttattagcg
gctttagataaactccaacaagattttgattatctcattatagatacggctgcaggcatt
ggggatgatgttcttgattttattagagcctcacagttttcaattattattattaccccc
gaacccacttctttaactgactccttttcattacttaaagttttaaaacgctcaaactat
aatcgaacttcatatattctcgtgaatatggctttagatgccgagaatagccaagcaata
tataaacgttttgagtcggctgtaaaaaaatatattgatgttgacattaactacctgggc
tatattcaagtagatgaaaccatgatttcatccatcaggcttcaatgccctgctgtattg
ttaagtccagactctaatgcaagtggctgctttaaaaaattggctcaagaattagacaaa
gaggttgctgaacaaactgtcgactcattcagtgagttttggcgccagcaagatggcatt
gactcacgtgctcaaacaccttctgaaacaccagtcgttacgtttaaagaagacacttta
cctaatactgttacaccgcctgctagtgtaaaaacaccgcttagctttaaacaagccgcc
gatttttgcattgcccaattatcaacgggtgatgtaacagaagaagattcagccgctttt
ttagagcaacttacccagtttcaaccacaagtacccgaagagcccacgactcaagcagat
caagcaccctcttcgtcatctatccgagaactatacaattaccttgaacaacgctctttt
cctaaagacgaactgcgagaaatcgtcacaacacttgagcaagtatattttgaaaaacac
gcggaaagtcttaatagttttgaatcgagcagcttaaaattatttgctcagttcagcgga
aatgaagacgacttacactatctcaatcagcaacttagttcatgtttccaacgcgaattt
aagaagccgctatatgatgttcttgagcaccttgaaagtttagtcagctcaaacaatttt
agccagcaaagctttgacgacctgttaagtgaattattatccagttatcagaaaaaattt
aatgaggcttataaaaccatggctgatgaaaacctcaaatccgcaagggaagaaatttca
gttttacaaaagcaattaagcgacattaataacgaactaaatgacacaaacaacacgcta
accgaaaaaataatgctgttaaataagatccaagcacttctaccctcttcctaa

DBGET integrated database retrieval system