KEGG   Crocosphaera subtropica: cce_0302Help
Entry
cce_0302          CDS       T00686                                 

Gene name
cmpD
Definition
(GenBank) bicarbontate transport system ATP-binding protein
  KO
K11953  bicarbonate transport system ATP-binding protein [EC:3.6.3.-]
Organism
cyt  Crocosphaera subtropica
Pathway
cyt02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cyt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    cce_0302 (cmpD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cyt02000]
    cce_0302 (cmpD)
Enzymes [BR:cyt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     cce_0302 (cmpD)
Transporters [BR:cyt02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Bicarbonate transporter
    cce_0302 (cmpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_22 AAA_16 RsgA_GTPase AAA_29 AAA_33 Dynamin_N AAA MMR_HSR1 S4 AAA_25 ATP-synt_ab AAA_15 RNA_helicase CBP_GIL AAA_28 NACHT AAA_23
Motif
Other DBs
NCBI-ProteinID: ACB49653
CyanoBase: cce_0302
CYORF: cce_0302
UniProt: B1X112
LinkDB All DBs
Position
complement(297616..298575)
Genome map
AA seq 319 aa AA seqDB search
MGLKCLFLLLLDPFCIPLIRGTCHYSPYINTEKIMHTIKSKNPKVLNLKPQPAMNHDFSV
VIENVSKVYPTPKGPYTVLQDVNLTVKEGEFICVIGHSGCGKSTLLNMVSGFATPTHGSV
LVNGKPVKKPGPDRMVVFQNYALLPWLTVFENVYLAVDAVHPNKREAEKRSIVRDHLAMV
GLTEAENKKPTQISGGMKQRVSIARALAIRPEVLILDEPFGALDAITKEELQEELLKIWN
DHRCTVLMITHDIDEALFLADRLVMMTNGPAANIGEIMNIPFPRPRDRDRIMEDPQYYDL
RNYALDFLYNRFAHDDDAA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggggttaaaatgcctgttcctattgctgcttgaccccttttgcatccccctgataagg
gggacttgccattattcaccctacataaatacggagaaaattatgcacacgatcaaatcg
aaaaaccccaaagttcttaacctaaaacctcaacctgctatgaatcatgatttttcggtt
gttattgaaaacgttagtaaggtttatcccactcccaagggaccttatacggttttacaa
gatgttaatttaaccgttaaagaaggggaatttatctgtgttattggtcattctggctgt
ggaaaatctacccttttaaacatggtgtcagggtttgccactcccactcacggatcagtc
ttagttaatggaaaaccggtcaaaaaaccagggcccgatcgcatggtggtgttccaaaat
tatgctttacttccttggttaaccgtgtttgaaaacgtctatttagcggtggatgctgtc
catcctaacaagcgagaagccgaaaaacgatctattgtacgggatcacctggccatggta
ggtttaaccgaagcagaaaacaaaaaacccacccaaatatcaggaggaatgaaacaacgg
gtttctatcgcgcgcgctttagctattcgtccagaagtgttaatcttagatgagcctttt
ggtgcgttagatgctatcaccaaagaggaattacaagaagaattgctgaaaatttggaat
gatcaccgttgtacggtgttaatgattacccatgatattgatgaggcgttatttttggca
gatcgtctcgttatgatgaccaacgggccggctgctaatattggggaaatcatgaatatt
ccttttcctcggcccagggaccgcgatcgtattatggaagatccccaatactatgatctt
cgcaactatgctttagattttctttataacagatttgcccacgatgatgatgcagcctag

DBGET integrated database retrieval system