KEGG   Crocosphaera subtropica: cce_0805Help
Entry
cce_0805          CDS       T00686                                 

Definition
(GenBank) putative ATP-NAD/AcoX kinase
  KO
K00858  NAD+ kinase [EC:2.7.1.23]
Organism
cyt  Crocosphaera subtropica
Pathway
cyt00760  Nicotinate and nicotinamide metabolism
cyt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    cce_0805
Enzymes [BR:cyt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.23  NAD+ kinase
     cce_0805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_kinase DAGK_cat Tugs
Motif
Other DBs
NCBI-ProteinID: ACB50156
CyanoBase: cce_0805
CYORF: cce_0805
UniProt: B1WR98
LinkDB All DBs
Position
823604..824527
Genome map
AA seq 307 aa AA seqDB search
MELKQVIIAYKAGDTQSKQWAQQCARELEALDCKVLMGPSGYKDNPYPVFLSSASEKIDL
AIVLGGDGTILAAARQLAPESIPILAVNVGGHLGFLTEPFELFKDTQQVWDRLRSDRYAM
LQRMMLEARVCEGDRCSPQSSSDRFYCLNEMCIKPASIDRMPTAILELEVDGEVVDQYQG
DGLLVATPTGSTCYTASANGPIIHPGMDAIAVTPICPLSLSSRPIVIPPGSVVDIWPLGD
YELNTKLWTDSSLATSIWPGQWISVKMAHCMARFIVLRENYSFYQTLREKLQWAGTRIHF
DNNHRVN
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtggaactcaaacaagttatcattgcttataaagcaggagacacccagagtaaacaatgg
gcgcaacagtgcgctagagaactagaagcccttgattgtaaagtattaatggggccaagt
ggttataaagataatccctatcccgtgtttctttcctccgcttcagaaaaaattgattta
gccattgttttagggggagatggaaccattttagctgctgcccgacaattagccccagaa
agcattcctattttagcggtgaatgtaggaggacatttaggctttttaaccgaacctttt
gaattgtttaaagatacccaacaagtttgggatcgtctgcgaagcgatcgctatgcgatg
ttacagaggatgatgttagaagctagggtgtgtgaaggcgatcgctgttcccctcagtcg
agtagcgatcgcttctattgtctcaacgaaatgtgcattaaaccggctagtatcgaccga
atgcccaccgctatcttagaactagaagtcgatggggaagtggtggatcaatatcaaggg
gatggcttattagtggcgactcctactggttcaacctgttacacggcctctgctaatggg
cctattattcaccctggaatggatgcgatcgctgttactcccatttgccctttaagtctg
tcgagtcgtcccattgttattccacccggttcggtggtggatatttggcccctaggagat
tatgaattaaatactaaattatggactgatagttctttggctacgtctatttggcccggt
caatggatatcagtaaaaatggcccattgcatggctaggtttattgtcttacgagaaaat
tattctttctatcaaaccctacgagaaaaattacaatgggcaggaacaagaattcatttt
gataataatcatcgggttaattag

DBGET integrated database retrieval system