KEGG   Crocosphaera subtropica: cce_0882Help
Entry
cce_0882          CDS       T00686                                 

Gene name
pstB1-2
Definition
(GenBank) phosphate ABC transporter, ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
cyt  Crocosphaera subtropica
Pathway
cyt02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cyt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    cce_0882 (pstB1-2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cyt02000]
    cce_0882 (pstB1-2)
Enzymes [BR:cyt01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     cce_0882 (pstB1-2)
Transporters [BR:cyt02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    cce_0882 (pstB1-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_15 AAA_22 AAA_16 AAA_23 RsgA_GTPase AAA_29 Rad17 AAA_33 PRK
Motif
Other DBs
NCBI-ProteinID: ACB50233
CyanoBase: cce_0882
CYORF: cce_0882
UniProt: B1WS39
LinkDB All DBs
Position
complement(885298..886110)
Genome map
AA seq 270 aa AA seqDB search
MRFNKKMMTNVATETVLRTENLNVFYGSNLAVRDVTLDIPINKVVAFIGPSGCGKSTVLR
CFNRMNDLIPSARIDGKITYHGKDIYTKKVDPVDLRCRIGMVFQKPNPFPKSIYENIAFG
ARLNGYKGDMSELVETSLKKASVWDETKDKLHQSGLALSGGQQQRLCIARAIAVKPDVIL
MDEPCAALDPISTLKIEELIHELKKDYTIVIVTHNMQQASRVSDLTAFYNAEATPKGGKV
GYLVEYDQTEVVFQNPAEEATRDYVSGRFG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
ttgaggttcaacaaaaaaatgatgactaatgtagcaacggaaaccgtcttaagaactgaa
aacttaaacgttttctacggttctaatttagctgttagggatgttaccttagacattcct
attaataaagtggtggcgtttattggtccttcgggatgtggaaaaagtacggttttacgc
tgttttaatcggatgaatgatctcattcctagtgcgagaatcgacgggaaaattacctat
cacgggaaggatatttataccaaaaaagttgaccctgtagacttacggtgtcgcattggt
atggtattccaaaaacctaacccgttccccaagtctatctacgaaaatattgcttttggt
gctagattgaacgggtataaaggagatatgagtgagttagtggaaacctccttaaaaaaa
gcctcggtatgggatgaaacgaaagataaattgcatcaaagtgggttagccttgtctgga
ggacaacaacaacgattgtgtattgcacgggcgatcgccgttaaaccagatgttatttta
atggatgaaccttgtgcagcgttagaccccatttctactctaaaaattgaagaattaatc
cacgaactcaagaaagattacaccattgtgattgttacccacaatatgcagcaagcgtca
cgggtatcagatttaacggcgttttataacgcagaagccactcctaaagggggtaaagtg
ggttatttagtagaatatgatcaaactgaggtggtctttcaaaatcctgcggaggaagcc
actagggactatgttagcggacgatttggttaa

DBGET integrated database retrieval system