KEGG   Cyanothece sp. ATCC 51142: cce_1620Help
Entry
cce_1620          CDS       T00686                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cyt  Cyanothece sp. ATCC 51142
Brite
Enzymes [BR:cyt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     cce_1620 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Phage_portal
Motif
Other DBs
NCBI-ProteinID: ACB50970
CyanoBase: cce_1620
CYORF: cce_1620
UniProt: B1WXY3
LinkDB All DBs
Position
complement(1632567..1633169)
Genome map
AA seq 200 aa AA seqDB search
MAYELPNLPYDYTALEPHISKSTLEFHHDKHHASYVSKYNAAVEGTDHDSKPIEEVIKAI
AGDASKQGLFNNAAQAWNHSFYWNCMKPGGGGQPTGPLADKINADFGSFDKFVEEFKNAG
ATQFGSGWAWLVLDNGTLKVVKTLNAENPMTSGQTPLLTMDVWEHAYYLDYQNSRPGYID
TFVSSLINWDFVADNLAKAS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcatacgaactacctaatttaccttacgactatactgcattagagcctcacattagt
aagagtaccctagaatttcaccacgacaagcatcatgcttcctatgtgagcaagtataat
gcagcagtagaaggcacagaccatgattctaaacccatcgaagaagtcattaaagcgatc
gctggtgatgcttctaaacagggtttatttaataacgctgcccaagcgtggaatcactct
ttttactggaattgtatgaaacccggtggcggtggccaaccaactggtccattagctgat
aaaattaacgctgattttggtagctttgacaaatttgttgaagaatttaaaaacgcaggt
gcaacccaatttggtagcggttgggcttggttagttcttgataacggaactttaaaagtt
gtcaaaaccctaaacgcagaaaaccctatgacttctggacaaacccccttattaaccatg
gatgtctgggaacacgcttattatttagactatcaaaatagccgtcctggttatattgat
acttttgttagtagcttaattaattgggactttgttgccgataacctggctaaagcttcc
taa

DBGET integrated database retrieval system