KEGG   Crocosphaera subtropica: cce_2420Help
Entry
cce_2420          CDS       T00686                                 

Definition
(GenBank) ATP-binding protein of ABC transporter
  KO
K06147  ATP-binding cassette, subfamily B, bacterial
Organism
cyt  Crocosphaera subtropica
Brite
KEGG Orthology (KO) [BR:cyt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cyt02000]
    cce_2420
Transporters [BR:cyt02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    cce_2420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane SMC_N AAA_16 AAA_29 MMR_HSR1 RsgA_GTPase DUF87 AAA_21 DUF815 Zeta_toxin Septin AAA_22 AAA_23 AAA_10 T2SSE AAA_7 NACHT DUF4446 AAA_33 AAA_18 MobB
Motif
Other DBs
NCBI-ProteinID: ACB51768
CyanoBase: cce_2420
CYORF: cce_2420
UniProt: B1WRB9
LinkDB All DBs
Position
complement(2472836..2474740)
Genome map
AA seq 634 aa AA seqDB search
MKHKLLQLCLNTETNSINHNFFQINNKSKTMISWKDLLKSYHNHRSIAVYSILASGALQI
VDLMVPYITGQIINVLSHQPIDSILENLVNSLANITNFPNNQIFSLAVLLGIIFVVTVVR
SPIQPWLTDWFHWEIALKVRREQLKNTVRKILTLPLSFYDEYNPGRITNRIAKGVENQLW
TYPEIAGELMPKIIRVLGIFVIILLIEWKIALLFLISFTLILFFSIKHLNKILKQEELLD
KHSENTQSFSSELITNIKTVKAFATERRELSRQDKRLDREFKYVLFRIHTGYVKLVTWQK
TVIQSSVFLILVYSLIITVQGHISLGHFITLITVSSMAYAELDPITQLAEIFARRYSSIS
RFHEFLHIPSGEDKAILTQESINHEPYQFTGKIHLSNLSFAYHENHWVLQNINLLIHPYE
TVAIVGKSGSGKSTLIKLLLRYFKPTQGQILIDGKDIQTLDIVQYRQRLAMVHQEVEIFN
GTLLDNLTYGNRTVSFEAVEQACQIARVDEFITQFPQGYYTIVGERGVRLSGGQRQRIGI
ARALIVDPDVLIFDEATSSLDYESEKLIQLAMSSILGTRTTIIIAHRLSTVREADKIIVL
DNGQIVEVGNHQQLLNHQGIYHRLHSLQETGELS
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacacaagttactacaattgtgtttaaatacagaaactaactcaattaatcataac
tttttccaaataaataacaaaagtaaaacaatgatatcttggaaagatttactaaaatcc
tatcataatcataggagtattgctgtttatagcatcttagcctctggcgctttacaaatc
gttgatttaatggttccttatatcacaggacaaattatcaatgttctgtctcatcaacct
atcgatagtattttagaaaatttagttaattctctagctaatatcactaattttcctaat
aaccagatattttctttagctgttttattaggaattatctttgtagtaacagttgtgcgt
tctcccattcaaccctggttaacagattggtttcactgggaaattgccttaaaagttcgt
cgagaacagctaaaaaataccgtcagaaaaattctcacactaccgttatctttttatgat
gaatataaccctggacggattactaaccgcattgccaaaggagttgaaaaccagttatgg
acttatccagaaatagctggagagttaatgccgaagattatcagggtgttgggtattttt
gtgattattttattaattgaatggaaaattgctctgctttttctcatttcttttaccctc
attttattctttagcattaaacatttaaacaaaattcttaaacaagaagagttactagat
aaacatagtgaaaacacccaaagttttagttcagaactaattaccaatatcaagactgtt
aaagcatttgccaccgaaagaagagaattatctcgacaagataaaagattagatcgagag
tttaaatatgtcttgtttcgcattcatacaggctatgtaaaattagtgacatggcaaaaa
accgtcattcaatcttcagtatttttaattcttgtttatagtttaatcattacagtacaa
ggtcatatttccttgggtcattttattactctgattacagtttctagtatggcctatgca
gaattagatcccattacccaactagcagaaatttttgctcgtcgttatagttccatttct
cgctttcatgagtttctacatattccctcaggagaagataaagcgattctaactcaggaa
tctattaaccatgaaccctaccaatttacagggaaaatacacctaagtaacttatccttt
gcttaccacgagaatcattgggttcttcaaaatattaacctgttaattcatccctatgaa
actgtggccattgttggtaaatcagggtcaggaaaatccacattaatcaaactattatta
cgctattttaaaccaacccaaggacaaatattaatcgatggcaaagacattcaaacctta
gatatcgttcaatatcggcaacgattagcgatggttcatcaagaggtagaaatatttaat
ggaaccctattagacaatttaacctatgggaatagaactgttagttttgaagcagtagaa
caagcctgtcaaattgctagagttgatgaatttattacccagtttcctcaaggttactat
actattgtcggagaaagaggtgtgcgcttatcaggaggacaacgacaaagaatcggcatc
gctagagccttaattgttgatcctgatgtattgatttttgatgaagctacctctagttta
gattatgaatcagaaaaattgattcagttagccatgtcctctattttaggcacaagaact
accataattattgctcatcgcttaagtaccgtgcgagaagctgataaaattattgtctta
gataatggacaaattgttgaagtaggaaatcaccaacaacttttaaatcatcaaggtatt
tatcatcgtttacattctttacaagaaacaggagaattatcttaa

DBGET integrated database retrieval system