KEGG   Cyanothece sp. ATCC 51142: cce_2750Help
Entry
cce_2750          CDS       T00686                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
cyt00010  Glycolysis / Gluconeogenesis
cyt00020  Citrate cycle (TCA cycle)
cyt00620  Pyruvate metabolism
cyt01100  Metabolic pathways
cyt01110  Biosynthesis of secondary metabolites
cyt01120  Microbial metabolism in diverse environments
cyt01130  Biosynthesis of antibiotics
cyt01200  Carbon metabolism
Module
cyt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cce_2750 (pdhC)
   00020 Citrate cycle (TCA cycle)
    cce_2750 (pdhC)
   00620 Pyruvate metabolism
    cce_2750 (pdhC)
Enzymes [BR:cyt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     cce_2750 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 SOG2 AATase
Motif
Other DBs
NCBI-ProteinID: ACB52098
CyanoBase: cce_2750
CYORF: cce_2750
UniProt: B1WU36
LinkDB All DBs
Position
complement(2806558..2807859)
Genome map
AA seq 433 aa AA seqDB search
MIHDIFMPALSSTMTEGKIVSWVKSPGDKVSKGETVVVVESDKADMDVESFYDGYLATIL
VEAGQEAPVGDAIALIAETEEEIAQAKAKGSSGLSTPPPESPPKKEEKQPSQAPATTATA
TATAPSSTNGKSNRIVASPRAKKLAKQLGISLNSVEGSGPYGRIVAEDIEKAAGKTPTPP
SIPTQTTQPPKPTQTPTVAPATPTPAPVTAGETVPLNTLQKAVVQNMVATLQVPTFHVGY
TITTDELDKLYKKLKPKGVTMTALLAKAVAVTLEKHPLVNANYSEQGIRYPQSINIAIAV
AMPDGGLITPVLQNADKVDIYSLSRTWKDLVDRARAKQLQPEEYNSGTFTLSNLGMFGVD
RFDAILPPGQGSILAIGASSPQVVATPDGLLGVKRQMAVNITCDHRIIYGSHAAAFLQEF
ANLLETDVQSLTM
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgatattttcatgcctgcattaagttctaccatgaccgagggaaaaattgtc
tcttgggtgaagtctccaggggataaagtttctaaaggtgaaaccgtggtcgtcgtagaa
tcagataaagcagatatggatgtagaatctttctatgatggctatctagcaactatttta
gtcgaagcagggcaagaagcccccgttggagatgcgatcgctttaatcgcagaaaccgaa
gaggaaattgcccaagccaaagcaaaaggctcctctggtttatctacacccccccctgag
tccccccctaaaaaagaagaaaaacaaccctctcaagcccctgcaaccaccgctacagca
accgctacagccccctcttcaactaacggcaaaagtaaccgcattgtggcttctcccaga
gccaaaaaattagccaaacaattagggatctctctcaacagtgttgaagggagtggcccc
tatggcagaattgtggcagaagatattgaaaaggccgcaggaaaaacccctacaccccct
tctattcccacgcaaaccacccaaccccctaaacccactcaaaccccaactgtggcccct
gcaaccccaacaccagcccctgttaccgcaggagaaaccgtacccctcaataccctacaa
aaagcagtggtgcaaaacatggtggctaccctacaggttcctactttccatgtgggttat
accattaccaccgatgagttagataagctctataagaaactgaagcccaaaggggtaacc
atgaccgcattattggctaaagcagtggctgttaccctggaaaaacatcctttagttaac
gccaattacagcgagcaaggcattcgttatcctcagtcgattaatattgcgatcgccgtt
gctatgcccgatggtggtttaattactcccgtcttacaaaatgccgacaaagttgacatc
tattctctatctcgtacctggaaagatttagtagacagagcaagagccaagcagttacaa
ccagaagaatataatagcggtacatttaccctatccaatttaggaatgtttggcgttgat
cgctttgatgccattttaccccccggacaaggttccattttagcgatcggtgcatcaagt
ccccaagtggtagccactcccgatgggttattaggggttaaacgtcaaatggctgttaat
attacctgcgatcatcgtattatttacggttcccatgcggctgctttcttgcaagagttt
gctaacttgttagaaacagatgtgcaatctttgactatgtaa

DBGET integrated database retrieval system