KEGG   Crocosphaera subtropica: cce_2750
Entry
cce_2750          CDS       T00686                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyt  Crocosphaera subtropica
Pathway
cyt00010  Glycolysis / Gluconeogenesis
cyt00020  Citrate cycle (TCA cycle)
cyt00620  Pyruvate metabolism
cyt01100  Metabolic pathways
cyt01110  Biosynthesis of secondary metabolites
cyt01120  Microbial metabolism in diverse environments
cyt01200  Carbon metabolism
Module
cyt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cce_2750 (pdhC)
   00020 Citrate cycle (TCA cycle)
    cce_2750 (pdhC)
   00620 Pyruvate metabolism
    cce_2750 (pdhC)
Enzymes [BR:cyt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     cce_2750 (pdhC)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 SOG2
Other DBs
NCBI-ProteinID: ACB52098
CyanoBase: cce_2750
CYORF: cce_2750
UniProt: B1WU36
LinkDB
Position
complement(2806558..2807859)
AA seq 433 aa
MIHDIFMPALSSTMTEGKIVSWVKSPGDKVSKGETVVVVESDKADMDVESFYDGYLATIL
VEAGQEAPVGDAIALIAETEEEIAQAKAKGSSGLSTPPPESPPKKEEKQPSQAPATTATA
TATAPSSTNGKSNRIVASPRAKKLAKQLGISLNSVEGSGPYGRIVAEDIEKAAGKTPTPP
SIPTQTTQPPKPTQTPTVAPATPTPAPVTAGETVPLNTLQKAVVQNMVATLQVPTFHVGY
TITTDELDKLYKKLKPKGVTMTALLAKAVAVTLEKHPLVNANYSEQGIRYPQSINIAIAV
AMPDGGLITPVLQNADKVDIYSLSRTWKDLVDRARAKQLQPEEYNSGTFTLSNLGMFGVD
RFDAILPPGQGSILAIGASSPQVVATPDGLLGVKRQMAVNITCDHRIIYGSHAAAFLQEF
ANLLETDVQSLTM
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgattcacgatattttcatgcctgcattaagttctaccatgaccgagggaaaaattgtc
tcttgggtgaagtctccaggggataaagtttctaaaggtgaaaccgtggtcgtcgtagaa
tcagataaagcagatatggatgtagaatctttctatgatggctatctagcaactatttta
gtcgaagcagggcaagaagcccccgttggagatgcgatcgctttaatcgcagaaaccgaa
gaggaaattgcccaagccaaagcaaaaggctcctctggtttatctacacccccccctgag
tccccccctaaaaaagaagaaaaacaaccctctcaagcccctgcaaccaccgctacagca
accgctacagccccctcttcaactaacggcaaaagtaaccgcattgtggcttctcccaga
gccaaaaaattagccaaacaattagggatctctctcaacagtgttgaagggagtggcccc
tatggcagaattgtggcagaagatattgaaaaggccgcaggaaaaacccctacaccccct
tctattcccacgcaaaccacccaaccccctaaacccactcaaaccccaactgtggcccct
gcaaccccaacaccagcccctgttaccgcaggagaaaccgtacccctcaataccctacaa
aaagcagtggtgcaaaacatggtggctaccctacaggttcctactttccatgtgggttat
accattaccaccgatgagttagataagctctataagaaactgaagcccaaaggggtaacc
atgaccgcattattggctaaagcagtggctgttaccctggaaaaacatcctttagttaac
gccaattacagcgagcaaggcattcgttatcctcagtcgattaatattgcgatcgccgtt
gctatgcccgatggtggtttaattactcccgtcttacaaaatgccgacaaagttgacatc
tattctctatctcgtacctggaaagatttagtagacagagcaagagccaagcagttacaa
ccagaagaatataatagcggtacatttaccctatccaatttaggaatgtttggcgttgat
cgctttgatgccattttaccccccggacaaggttccattttagcgatcggtgcatcaagt
ccccaagtggtagccactcccgatgggttattaggggttaaacgtcaaatggctgttaat
attacctgcgatcatcgtattatttacggttcccatgcggctgctttcttgcaagagttt
gctaacttgttagaaacagatgtgcaatctttgactatgtaa

DBGET integrated database retrieval system