KEGG   Cyanothece sp. ATCC 51142: cce_3229Help
Entry
cce_3229          CDS       T00686                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
cyt00010  Glycolysis / Gluconeogenesis
cyt00053  Ascorbate and aldarate metabolism
cyt00071  Fatty acid degradation
cyt00280  Valine, leucine and isoleucine degradation
cyt00310  Lysine degradation
cyt00330  Arginine and proline metabolism
cyt00340  Histidine metabolism
cyt00380  Tryptophan metabolism
cyt00410  beta-Alanine metabolism
cyt00561  Glycerolipid metabolism
cyt00620  Pyruvate metabolism
cyt00625  Chloroalkane and chloroalkene degradation
cyt01100  Metabolic pathways
cyt01110  Biosynthesis of secondary metabolites
cyt01120  Microbial metabolism in diverse environments
cyt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cyt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cce_3229
   00053 Ascorbate and aldarate metabolism
    cce_3229
   00620 Pyruvate metabolism
    cce_3229
  09103 Lipid metabolism
   00071 Fatty acid degradation
    cce_3229
   00561 Glycerolipid metabolism
    cce_3229
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    cce_3229
   00310 Lysine degradation
    cce_3229
   00330 Arginine and proline metabolism
    cce_3229
   00340 Histidine metabolism
    cce_3229
   00380 Tryptophan metabolism
    cce_3229
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    cce_3229
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    cce_3229
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    cce_3229
Enzymes [BR:cyt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     cce_3229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: ACB52577
CyanoBase: cce_3229
CYORF: cce_3229
UniProt: B1WXN6
LinkDB All DBs
Position
complement(3338393..3339865)
Genome map
AA seq 490 aa AA seqDB search
MVTATRPESKAKIGPTQLLINNEWIESASGKRFETINPTTGEVICDVAEADATDVDKAVK
AARNAFNQGDWPNLSASQRGQLLYKLADLIEANIEELARLETLDNGKPYQDSLNADLQLV
IACYRYYAGWADKIQGKTIPINGPYFCYTRHEPVGVVGQIIPWNFPLLMQAWKLAPALAA
GNTVVMKTAEQTPLSAFRVGELIIEAGFPPGVVNLLSGYGPTAGQAIARHHDIDKVAFTG
STEVGHLIMEAAAQTNLKRVTLELGGKSPNIVFADANLDQAIEGAHFGLFFNQGQCCCAG
SRLFVEEKCYDEFVAKSVERAKQRIVGDPFDDHTTQGPQVDKTQFDKVMEYIESGQREGA
KLLCGGGRVGDRGYFIEPTVFADVQDDMKIAQEEIFGPVMSIIKFKDMDEVIQRANDTMY
GLAAAVWTQDISKGHAIANALRAGTVWVNCYDVFDAAAPFGGFKQSGMGRELGEYGLQQY
TEIKTVTVKL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggtcacagcaacacgaccagaaagcaaagctaaaataggtccaactcaactattaatc
aataatgaatggatagaaagtgcttcaggaaaacgctttgaaaccattaacccaaccaca
ggggaagtcatctgtgatgtcgctgaagcggatgcaactgatgtcgacaaagccgtcaaa
gctgccagaaacgcctttaaccaaggagactggccaaacctatcggctagtcaacggggg
caacttctctataaattggctgatttaatcgaagctaacatcgaagaattagcccgtctg
gaaacgttagataacggaaaaccttatcaagactccttaaacgcagatttgcagcttgtt
attgcctgttatcgctactatgcaggatgggcagacaaaattcaaggaaaaaccattccg
atcaacggcccttatttctgttacactcgccatgaacccgttggcgtggtggggcaaatt
attccttggaattttccccttttaatgcaagcatggaaactcgcccccgctttggccgca
ggaaacaccgtggtcatgaaaaccgccgaacaaacccccttatccgccttcagagtcgga
gaattaataatagaagccgggtttcccccaggggtagttaacttactctcaggatacggc
cccactgcaggacaagcgatcgcccgtcatcacgatattgataaagtggcctttaccgga
tcgacagaagtgggccatttaatcatggaagcggccgcccaaaccaacttaaagcgtgtc
accctcgaattagggggtaaaagcccaaatattgtttttgccgatgctaatctggatcag
gctatcgaaggggcgcattttggtctattctttaaccagggtcaatgttgttgcgctgga
tctcgtctatttgtagaagagaaatgttatgacgagtttgtggcgaaaagtgttgaacgg
gctaaacaacgcattgtcggtgatccctttgatgatcacaccacccaaggaccccaagtg
gataagactcaatttgataaggtcatggagtatattgagtcagggcaacgggaaggggca
aaactactgtgtggtggtggccgtgtgggcgatcgcggttacttcattgaacccactgtc
tttgctgatgtgcaagatgatatgaaaattgcccaagaagagatttttggtccagtgatg
agtattatcaagttcaaagacatggatgaagtgatccaacgggctaatgatactatgtat
ggcttagcggctgctgtgtggactcaggatattagtaagggtcatgcgatcgccaatgcc
ttgcgtgccggtactgtctgggtcaactgttatgatgtcttcgatgctgctgcgcctttt
ggtggctttaaacagtctgggatgggtcgggaattaggagaatacggcctacaacaatac
acagaaattaagacagttacggtgaaactttaa

DBGET integrated database retrieval system