KEGG   Crocosphaera subtropica: cce_3700Help
Entry
cce_3700          CDS       T00686                                 

Definition
(GenBank) ATP-binding protein of ABC transporter
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
cyt  Crocosphaera subtropica
Brite
KEGG Orthology (KO) [BR:cyt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cyt02000]
    cce_3700
Transporters [BR:cyt02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    cce_3700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 DUF4162 AAA_23 ATPase_2 RsgA_GTPase AAA_30 AAA_28 AAA_15 AAA_22 AAA_16 AAA_29 AAA_33 Zeta_toxin AAA_13 TsaE AAA_24 NYD-SP28_assoc NACHT PhoH AAA
Motif
Other DBs
NCBI-ProteinID: ACB53048
CyanoBase: cce_3700
CYORF: cce_3700
UniProt: B1X1L8
LinkDB All DBs
Position
complement(3829471..3830424)
Genome map
AA seq 317 aa AA seqDB search
MIVSELAIATFNLTKQFERHVAVNKLELEVQPGEVYGLIGPNGAGKTTLMRMLAAVEEPT
TGEIHIYGDRLLTDNSHPRLKQKLGYLPDDFPLYEDLNVWDYLDYFARLYHVKLPHRRRR
IQEVLELVQLTSKKDSNIKTLSRGMKQRLSLARTILHDPLLLLLDEPVSGLDPIARMQFR
EVIKILQSVGMTVLISSHVLSDLAELCTSVGIMELGSLVESTSLKDLYERLSHQQIIIKT
LGDLTQLQQELKGFSQVEEWEIISHQNSLRVNFSGGDEESAELLKYLIHRGIPIAEFHCT
QEDLESIFLKLDHKQAS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgatagtctcagaattagcgatcgccacctttaacctgactaagcaatttgaacgccat
gttgcggtcaataagctagaattggaggtacaacctggagaagtgtacggcttaattggt
cctaatggtgcagggaaaaccaccttgatgcgaatgttggccgctgttgaagaacccacc
acaggggaaattcatatttatggcgatcgcttattaacggataatagtcaccctcgtctt
aaacaaaaattaggctatcttcccgatgatttccctttatatgaagacctcaatgtttgg
gattatttagattattttgctagactgtatcacgtcaaattaccccatcgtcgtcgtcgc
attcaagaagttttagaattagtccaattaaccagtaaaaaagatagcaatattaaaacc
ctttcacggggaatgaaacaacgattgagtttagctagaactatcttacacgatcccctt
ttattattattagacgaaccggtttctggattagatcccattgctagaatgcagtttagg
gaagtcataaaaatcttgcaaagtgtgggaatgacggttttaatctcttcccatgtatta
agtgatttagccgaattatgtacttctgttggtattatggaactgggatcgttagtagaa
agtacctcattaaaagatctatatgaacggttatcccaccaacaaatcattatcaaaacc
ttgggagatttaacccaattacaacaagaattaaaaggcttctctcaagtagaagaatgg
gaaattatttctcatcaaaatagtttacgagtgaacttttcaggaggagacgaagaaagt
gccgaattattaaaatatttaattcatcgaggtattcctatcgctgaatttcactgtact
caagaagatttagaatctatttttctaaaattagatcacaaacaagcatcataa

DBGET integrated database retrieval system