KEGG   Crocosphaera subtropica: cce_3747Help
Entry
cce_3747          CDS       T00686                                 

Definition
(GenBank) unknown
Organism
cyt  Crocosphaera subtropica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BRCT GAS CENP-F_leu_zip Spc7 PTCB-BRCT ERM DUF1664 SYCE1 ATG16
Motif
Other DBs
NCBI-ProteinID: ACB53095
CyanoBase: cce_3747
CYORF: cce_3747
UniProt: B1X1R5
LinkDB All DBs
Position
3884697..3886301
Genome map
AA seq 534 aa AA seqDB search
MINPLIYEIGTLILVLGASGINYRQLRNSRLKREATLLNQQKELTQENENLSEKLQQLDS
LNEELRQKNNNLQQDYTHIKQQVTALEENVSQLHDEKNNLSKTIKQEQDKVNVAQQTNQS
LQQQKEQLEITYKKDLSNLEQKLESLQKDQEKTNTQLQETSKSNNSLNQELKTIIAKREE
LENSLNRQQETVASLEKQLETVSQEKNSLEKELQQRIKTITEEKQSLENSLNQQQKTIAS
LEKQLETVSQEKNSLEKELQQQIKTITEEKQSLENSLNQQQETVTSLEKQLETVSQEKNS
LEKKLQQQIKTITEEKQSLENSLNQQQEIISSLEKTRKTLEKENNSLQQEQQESQKVYDE
KDELKKQLKQQEEIVTKLQNQLNTIEQEKETVETQLKQEIEKIAKDKEKSSKGKIEETEN
ISDVNKKTESGEKKSKKKAEESQEKIKNEIILEGKKLVVVGSLNSMNREIAKSLVQQAGG
TLTSSPSSRTHYVVVGKNPGDKLKKAQKLGIAQLSEDQFLEALAATGITEINQE
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacccattgatttacgaaattggtacattaatccttgttttaggagcttctggt
atcaactatcgtcagcttcgtaacagtcgtctaaaacgagaagcaaccttattaaatcaa
caaaaagagttgactcaagaaaatgagaatttgagcgaaaaattacagcaacttgatagt
cttaatgaagaactgagacaaaaaaataataatttacaacaagattatactcatattaag
caacaagtgacagctttagaggaaaatgttagtcaattgcacgacgagaaaaacaattta
tctaagacgattaaacaagaacaagataaagttaatgtagctcaacaaacaaatcaatcg
ttgcagcaacaaaaagaacaattagaaataacttataaaaaagatttatctaacctagaa
caaaaactagaaagtcttcaaaaagatcaagagaaaaccaatactcaattacaagaaacc
agtaaaagcaataattctttgaaccaagagttaaaaacaataatagctaaacgagaagaa
ttagaaaatagtttaaaccgacaacaagaaactgttgcttccttagagaaacaactagaa
actgtatctcaggagaaaaatagtttagagaaagaactacaacagcgaattaaaacgatt
accgaagaaaaacagtctctagaaaatagtttaaatcaacaacaaaaaactattgcttcc
ttggagaaacaactagaaactgtatcccaggagaaaaatagtttagagaaagaactacaa
cagcaaattaaaacgattaccgaagaaaaacaatctctagaaaatagtttaaatcaacaa
caagaaactgttacttccttggagaaacaactagaaactgtatcccaggagaaaaacagt
ttagagaaaaaactacaacagcaaattaaaacaattaccgaagaaaaacaatctctagaa
aatagtttaaatcaacaacaagaaatcatctcatctctagaaaaaacacggaaaacctta
gaaaaagaaaataatagcttacagcaagaacaacaagaaagccaaaaagtttatgatgaa
aaagatgagcttaaaaaacaactcaaacaacaagaagaaatagttacaaaattgcaaaat
caactcaacacaatagaacaagaaaaagaaaccgtcgaaactcagctaaaacaagaaatt
gagaagattgctaaggacaaagaaaagtccagtaaaggtaaaatagaagaaactgaaaat
atttctgatgtaaataagaaaactgaatcaggagaaaaaaaatcgaaaaaaaaagcagaa
gaaagccaagaaaaaataaaaaatgaaattattttagaaggaaaaaaactggtcgtagtc
ggtagtcttaatagtatgaatagagaaatagccaaatccttagtgcaacaagcaggagga
acactaaccagttctccaagttctagaacccactatgttgttgttggcaaaaaccctgga
gacaaactgaaaaaagcacaaaaactaggaattgctcaactgtcagaagaccagtttcta
gaagcattagcagcaacaggaataacagaaattaaccaggaataa

DBGET integrated database retrieval system