KEGG   Candidatus Atelocyanobacterium thalassa: UCYN_03780Help
Entry
UCYN_03780        CDS       T01159                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cyu  Candidatus Atelocyanobacterium thalassa
Pathway
cyu00473  D-Alanine metabolism
cyu00550  Peptidoglycan biosynthesis
cyu01100  Metabolic pathways
cyu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cyu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    UCYN_03780
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    UCYN_03780
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    UCYN_03780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cyu01011]
    UCYN_03780
Enzymes [BR:cyu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     UCYN_03780
Peptidoglycan biosynthesis and degradation proteins [BR:cyu01011]
 Precursor biosynthesis
  Amino acid ligase
   UCYN_03780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ADB95115
UniProt: D3ENR5
LinkDB All DBs
Position
415199..416251
Genome map
AA seq 350 aa AA seqDB search
MKISIGLLFGGASEEHIVSINSARAILQALQIGNNLCKYNVIPIYIQRNGVWISGKIAEQ
VLQTKQALPLVLLKKEEKFQLWQFPTEVNQIDVWFPVLHGPNGEDGTIQGLLKMMQTPFV
GTSVLGSAIGMDKIVMKTIFSQAGFPQVKYLTLEYSKLFSNAQYYSQLCNDIRTNLGYPC
FIKPANLGSSVGVSKVSSHDELEIALKNAASYDNRIIIEEGIIARELECGVLGNDIPKAS
VVGEITFESDFYDYKAKYKDTSSKIHIPAQLPNHIIEKIQQMAINAFTTINGRGLSRVDF
FYIEGTQKIFINEINSFPGFTESSMYPELWIKTGLEFHELVDKLIELALK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatcaataggcttattgtttggcggagcctcagaagaacatatagtttctatt
aattcagctagagctattttacaagcattacaaataggtaataatctatgtaagtataat
gtaatacctatttatattcaaagaaatggtgtttggatatctggaaaaatagctgaacaa
gttttacaaaccaaacaagctttaccattagtattactaaaaaaagaagaaaaatttcag
ctatggcaatttccaactgaagtaaatcaaatagatgtttggtttccagttttacatggt
ccaaatggagaagatggaactattcagggcctattaaagatgatgcaaactccctttgtt
ggaactagtgtattaggatcagcaataggtatggataagattgtaatgaaaacaatattt
tcacaagcaggatttcctcaggttaaatatttaactcttgaatattctaaattgttttct
aatgctcaatactattctcaattatgtaatgatattagaacaaatcttggatatccatgt
tttattaaaccagccaatctgggttcttcagttggagtttcaaaagtctcttctcatgat
gaattagagattgctctaaaaaatgctgctagttatgacaatcgaatcattattgaagaa
ggaattatcgctagagaattagaatgtggagttttgggaaatgatattcctaaagcatct
gtcgtaggagaaattacttttgaaagtgatttctatgattataaagctaaatataaagat
actagttctaagatacatattcctgctcaattaccaaatcatataatagaaaaaattcaa
cagatggccattaacgcatttactacaattaatggtagaggattatctagagtagatttc
ttttatattgaaggaacccaaaaaatttttatcaatgagattaacagtttccctggcttt
acagagtctagtatgtatccagaattatggataaagacaggattagagtttcacgagcta
gtagataaattaattgaattagctttaaaataa

DBGET integrated database retrieval system