KEGG   Cycloclasticus sp. PY97N: CPC19_01140Help
Entry
CPC19_01140       CDS       T05126                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
cyy  Cycloclasticus sp. PY97N
Pathway
cyy00330  Arginine and proline metabolism
cyy01100  Metabolic pathways
cyy01110  Biosynthesis of secondary metabolites
cyy01130  Biosynthesis of antibiotics
cyy01230  Biosynthesis of amino acids
Module
cyy_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cyy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CPC19_01140
Enzymes [BR:cyy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     CPC19_01140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 Shikimate_DH GFO_IDH_MocA NAD_Gly3P_dh_N ApbA YflT
Motif
Other DBs
NCBI-ProteinID: ATI02112
LinkDB All DBs
Position
complement(215963..216790)
Genome map
AA seq 275 aa AA seqDB search
MNTKQIGFIGGGNMASSLIGGLVSNGYPADKLTVVDLDSEKLSYLNQTFGVNTLQDSKEL
ATKADVLVLAIKPQHMQSVAQDLGQAIQDKSPVVVSIAAGIRVEALDRWLGGHVPIVRCM
PNTPALVKTGATGLYANAQVTENQKDLVESLLRAVGVTVWVEEEHELDAVTALSGSGPAY
FFMIMEALEAAGIKAGLSQKTAQLLTQETALGAAKMALESSEPASVLRQRVTSPGGTTER
AIGILEEQGLRDILQAALLGAKERSIELSDELGNN
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaaaacagattggatttattggcggtggcaatatggccagcagcttaattggt
gggcttgttagtaatggttacccagccgataagctaaccgttgttgacctagatagtgaa
aaactgagctatttaaaccaaacatttggggttaataccttacaagacagcaaagagcta
gccactaaagcagatgttttggtattagcaataaaaccccaacatatgcaatcggttgca
caagatttagggcaggcgatacaggataaatcccctgttgtggtatctattgcagccggt
atccgagtggaggcccttgatcgttggttaggtggtcatgtaccgattgttcgttgtatg
cctaatacgccagcgctggttaaaacaggggcgacagggctttatgcaaatgctcaagtg
acggaaaaccaaaaagacttagtggaatccctgttacgtgcagttggagtgactgtgtgg
gtggaagaggagcatgagctggatgcggtgacagccttgtcaggtagtgggccagcctac
ttttttatgatcatggaagcgttggaggcggcaggaataaaggcgggtttgagccaaaaa
acagcgcaattattaacacaagaaacagctctaggtgcggcaaaaatggcgctagagtcg
agtgagccagcaagtgtattgcgtcaacgcgtgacctcacctggaggcacaacggagcgt
gctataggtattttggaagagcaggggctaagggatattttgcaggctgcgctgttggga
gcaaaagaacgctcaatcgagttatctgacgaattgggaaataactga

DBGET integrated database retrieval system