KEGG   Cycloclasticus sp. PY97N: CPC19_02230Help
Entry
CPC19_02230       CDS       T05126                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cyy  Cycloclasticus sp. PY97N
Pathway
cyy00030  Pentose phosphate pathway
cyy01100  Metabolic pathways
cyy01120  Microbial metabolism in diverse environments
cyy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CPC19_02230
Enzymes [BR:cyy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CPC19_02230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ATI02318
LinkDB All DBs
Position
complement(441458..443317)
Genome map
AA seq 619 aa AA seqDB search
MSWTKKVLRINLTNRTSSEEPLNMEWAELYLGQRGLATKYLTEEVDPTVEPLAPENKLYM
VTGPLTGTMASTGGRYSCVTKSPLTNALACSNSGGFFGNEMKCAGWDMIILEGKASSPVY
ISIVDEKCEILPADEIWGKSVWEADEWLHNKHQDPQLRIAAIGLPGEKGNLYSAIVNDLH
RAAGRSGVGAVMGSKNVKAVTLRGSKGVGNIKDPKRFFEATNKAKKIIADSEMTQGLSAL
GTNVMMNHMNEVGALPARNWQDSTFDNAPKLSSEAMAVPRESDGKPNLTRNAGCFACTIS
CGRISTIDPEHFSIKNRDDIHKHFKGNSGGNEYEAAWALGCDTGVDDLDAVTYANFVCNE
QALDPISAGATIAAAMELYELGILTKEDTGGIEMNFGNAEAMVECIELIAKHEGFGQELA
QSSLRFCEKYGRPDLAIVVKGQEFPAYDARAVKGMGLGYATSNRGACHVRGYTNGSETAG
IPFKTDPLAYEGKAELLMAFQDTTSVFDSAGICTFSSFAQGIEEVAEQIDAACEGDWTAE
RLGQLGERVWNLEREFNNNAGFTAADDTLPPRLLSEPVKAGPAKGEVCELDRMLPEYYEV
RGWNQDGTLKEATKQRLSL
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgagctggactaaaaaagtattacgcataaatctaacaaacaggacatcttctgaagaa
cctctcaatatggagtgggcagaactttatctaggccagagagggctagcgacaaagtac
cttacagaagaagtggacccaaccgtcgagcctctagcgccagaaaacaagctgtatatg
gtaacaggcccactaacaggcaccatggcttcaacgggtggtcgttactcttgtgtcact
aaaagccccttaaccaatgctctggcttgctcaaattcaggtggtttttttggcaacgaa
atgaaatgtgctggctgggatatgattatcctagaaggcaaagcaagctccccagtttat
atcagcatcgttgatgaaaaatgcgagatcctgccggcggatgaaatttggggcaaatct
gtttgggaagccgatgaatggcttcataataaacaccaagaccctcaactaagaatcgct
gctattggcctacctggtgaaaagggcaacctatattctgctatcgttaatgacttacat
cgtgctgctgggcgttccggcgtaggcgctgttatgggttcaaaaaatgtcaaagcggtg
acccttagaggcagcaaaggtgttggcaatataaaagatccaaaacgtttcttcgaagcc
actaacaaagctaaaaaaattatcgctgacagtgaaatgactcaaggcctcagcgcctta
ggtaccaatgtcatgatgaaccatatgaacgaagtgggtgctttaccggctagaaactgg
caagacagcacctttgacaatgcacctaaactgtcaagtgaggcaatggccgtaccaagg
gaaagtgacggtaagccaaacttaacacgaaatgccggctgctttgcctgcactatatct
tgtggacgtatctcaacaatcgacccagagcatttcagcattaaaaaccgtgatgacatc
cataagcactttaaaggtaattctggtggtaatgaatatgaagctgcatgggcattaggt
tgcgataccggtgtagatgatttagacgccgtgacctatgctaactttgtctgtaatgag
caagctcttgaccccatctcagcaggcgccactattgctgcagccatggagttatatgag
ctaggcatccttacaaaagaagatactggcggcattgaaatgaactttggcaatgctgag
gcgatggtggaatgtattgaactgattgcaaaacatgaaggctttggacaagaactcgct
caaagttcacttcgtttttgtgaaaaatacggccgcccagacctcgctattgttgttaaa
gggcaagagtttccagcctatgatgctcgtgctgtaaaaggcatgggtcttggatatgcc
acatcaaaccgtggcgcctgtcacgtacgtggttacactaacggctcagaaacagccggg
atacctttcaaaacagatccattagcctatgaaggaaaagcagaactactgatggcattc
caagatacaactagtgtgtttgattctgccggcatctgcaccttctcatcattcgcacaa
ggcattgaagaagtggcagaacaaattgatgctgcctgcgaaggcgactggacagctgaa
agactcggccaattaggcgagcgcgtttggaaccttgagcgtgagttcaacaacaatgct
ggtttcactgctgccgatgacacgcttccacctcgcttattaagtgagcctgtcaaagca
ggccctgcaaaaggtgaagtttgtgagttagatagaatgttgcccgaatactacgaagtt
cgtggttggaatcaagacggcacacttaaagaagcaacaaaacaacgcctaagtttgtaa

DBGET integrated database retrieval system