KEGG   Cycloclasticus sp. PY97N: CPC19_03900Help
Entry
CPC19_03900       CDS       T05126                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cyy  Cycloclasticus sp. PY97N
Pathway
cyy00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cyy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CPC19_03900
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cyy02000]
    CPC19_03900
Enzymes [BR:cyy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CPC19_03900
Transporters [BR:cyy02000]
 Other Transporters
  Pores ion channels [TC:1]
   CPC19_03900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_N_3 GST_N_2 GST_C_2 GST_N_5 Tom37 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ATI02640
LinkDB All DBs
Position
complement(783298..783909)
Genome map
AA seq 203 aa AA seqDB search
MKLYYSPGSCSLSPHIAIHEAGLTAKTELVKVDLQSHTLENGDNYLDINPCGYVPALQLD
SGEFLFEGPAIVQYIASLAPEKNLAPAADTFERAKLQQWLNFLSTELHKGLAPLFNPALS
DDTKGVFIEGYSKRLTQLVESMGDSEYLVGDQFSVADIYLFVILSWHPYFEFDASPWPSL
KAFQERIGSRPAVQEALKHEGLA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttattactccccaggatcatgttctttatctccacatattgctattcatgaa
gcaggtttaacagctaaaacagagctagtaaaagtagacttgcaatcacacactctcgag
aatggtgataactatcttgacattaacccttgcggttatgtgcctgcgttacagcttgat
agcggtgagtttttattcgaaggtcctgctattgtgcaatacatcgcaagcttagcacct
gaaaaaaacctagcacctgctgctgacacgtttgaacgtgcaaagttacagcaatggtta
aactttttatcaacagaattacataaaggacttgcgcctttatttaaccctgctctttct
gatgatacaaaaggtgtttttattgaaggttatagcaagcgcctaactcaattagttgag
tcaatgggtgatagtgagtacctagtaggtgatcagttctcagtagcagatatctactta
ttcgttatcttaagctggcacccatactttgaatttgatgcctcaccttggccatcactt
aaagcattccaagagcgtattggctctcgccctgctgtacaagaagcacttaagcatgaa
ggtttagcttaa

DBGET integrated database retrieval system