KEGG   Cycloclasticus sp. PY97N: CPC19_04070Help
Entry
CPC19_04070       CDS       T05126                                 

Definition
(GenBank) serine hydrolase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
cyy  Cycloclasticus sp. PY97N
Pathway
cyy00550  Peptidoglycan biosynthesis
cyy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyy00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CPC19_04070
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cyy01002]
    CPC19_04070
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cyy01011]
    CPC19_04070
Enzymes [BR:cyy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CPC19_04070
Peptidases [BR:cyy01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   CPC19_04070
Peptidoglycan biosynthesis and degradation proteins [BR:cyy01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CPC19_04070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13 DUF1381
Motif
Other DBs
NCBI-ProteinID: ATI02673
LinkDB All DBs
Position
complement(822012..823136)
Genome map
AA seq 374 aa AA seqDB search
MKRIILLLSFFLSSQAIALPIPSAPNLKARSYHLTDFHSGTVLASKDPDLKLAPASMTKI
MTALIVFRELNHGNLNLDDQVRISEKAWRTPGSRMFVEVNKFVTVDDLIHGMLVQSGNDA
TVALAEHIAGDESTFAQLMNQVAKDLGMKNSHFTNSSGLPDEQHYTTARDLSVLTRALII
ESPELYKINAIKSFSFNGITQQNRNKLLWRDSTVDGVKTGHTEDAGYCLVSSAVRDNMRL
ISVVMGTDSVAARNDINQALLNYGYRFYKTHLLYKAQQSLTTTRVWKGAIKSLPVGLAKD
LYLTIPRNEYKSLDASLALNPQLIAPIKKGQLVGNAVIQLKGDIIAKRPLIALQDIPEGS
FMDILKDEALLLLE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaattatcctgctgctgagcttttttctctcttctcaagccatcgcgttacct
attccttccgccccaaatttaaaagcgagaagctaccacctgaccgactttcacagtgga
acagttttagcctctaaagaccctgatttaaaactagcccccgccagcatgacaaaaatc
atgactgcgttaattgtctttcgtgaactaaaccatggaaatttgaatttagacgatcaa
gttcgtattagtgaaaaagcatggcgaactcctggttctagaatgtttgtggaagttaat
aaattcgttacggtcgatgatttaattcacggaatgcttgtgcaatcaggtaacgatgcc
actgttgcattagccgaacatatcgcaggggatgaatcaacttttgcacaattaatgaac
caagttgctaaagaccttggcatgaaaaatagccactttactaatagttctggtctgccc
gacgaacagcattacactaccgctagagacctctcagttctaactcgcgccttaatcatt
gagtctcccgagttatataaaataaatgcgatcaaatcattttcttttaacggtattact
caacaaaatagaaacaagctgttatggcgtgatagcacagtagacggcgttaaaacaggg
catacagaggacgctggttattgtttagtttcatctgctgttcgcgacaatatgcgttta
atttctgtcgttatgggcacagacagcgtagctgcacgaaatgatatcaatcaggccttg
ctgaattatggttaccgtttttataaaactcacttgctgtataaagcacaacaatcacta
accaccacccgcgtctggaaaggcgcgattaaatctttaccagtaggcttggcgaaagac
ctttacctgactattcctcgcaatgaatataaatcattagatgcgagcctagcgttaaac
ccccagctgattgcacccataaaaaaaggccaacttgttggcaacgcggttattcaactt
aaaggtgacattattgccaaacgcccactcattgctttacaagatattccggaagggtca
tttatggacatcctaaaagatgaagcattgttattgcttgagtag

DBGET integrated database retrieval system