KEGG   Cycloclasticus sp. PY97N: CPC19_05585Help
Entry
CPC19_05585       CDS       T05126                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
cyy  Cycloclasticus sp. PY97N
Pathway
cyy00020  Citrate cycle (TCA cycle)
cyy00270  Cysteine and methionine metabolism
cyy00620  Pyruvate metabolism
cyy00630  Glyoxylate and dicarboxylate metabolism
cyy00680  Methane metabolism
cyy01100  Metabolic pathways
cyy01110  Biosynthesis of secondary metabolites
cyy01120  Microbial metabolism in diverse environments
cyy01130  Biosynthesis of antibiotics
cyy01200  Carbon metabolism
Module
cyy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cyy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cyy_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cyy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CPC19_05585
   00620 Pyruvate metabolism
    CPC19_05585
   00630 Glyoxylate and dicarboxylate metabolism
    CPC19_05585
  Energy metabolism
   00680 Methane metabolism
    CPC19_05585
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CPC19_05585
Enzymes [BR:cyy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     CPC19_05585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ATI02957
LinkDB All DBs
Position
1120285..1121262
Genome map
AA seq 325 aa AA seqDB search
MKAPVHVAVTGAAGQISYSLLFRIASGDFLGPDQPICLHLLEITPALGALEGAVMELNDC
AFPLLQSVSMSDDAEVAFKDIDFAFLVGARPRGPGMERKDLLEANAAIFSVQGKALNKVA
KRDVRVLVVGNPANTNALIAMNNAPDLDPRNFTAMTRLDHNRAMSLLAEKTGNHNTDVTK
MTIWGNHSATQYPDLHNCLINGEDALSKVDASWYADDFIPAVQQRGAAIIKARGLSSAAS
AASSALDHMRTWVQGTADGDWVSMGIPSDGSYGIEEGLIYSFPVTVKDGDYSIVQGLEIN
DFSRERMIATENELKEERDGVKHLL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacctgttcatgtagccgttaccggcgccgctggtcaaatttcgtactcatta
ttatttcgtatagcatctggcgactttttaggcccagatcagccaatttgtttacaccta
ttagaaatcacacctgctttaggtgcgcttgagggtgcggttatggaattgaacgattgt
gcatttcctttattacaaagtgtttcaatgtctgatgatgctgaagttgcctttaaagat
atcgattttgcattcttagtaggtgctcgtccacgtggtcctggtatggaacgtaaagac
ttgttggaagcaaatgcggccatcttttcggtacaaggtaaagccttaaataaagttgct
aaacgtgatgttcgtgtattagtggtgggtaaccctgcaaatacaaatgcattgattgcg
atgaataatgcaccagaccttgacccacgtaacttcacagcaatgacacgtttagaccat
aatcgtgcgatgagcttattggccgaaaaaacgggtaatcataatacggacgttactaag
atgacaatctggggcaaccactcagcaacacaatacccagaccttcacaattgcttaatc
aacggtgaagatgcgttatctaaggtcgatgcaagctggtatgccgatgactttattcct
gctgttcaacaacgtggcgctgccattattaaagcacgtggcttgtcaagcgcagcgtct
gctgccagttctgcattagaccatatgcgtacttgggtgcaaggaacagcagacggcgat
tgggtgagtatgggaattccaagtgatggaagctatggtattgaagaaggtttaatttac
tcattccctgtgactgttaaagacggtgactattcaatcgttcaaggtcttgaaattaat
gattttagtcgtgaaagaatgatcgcaacggaaaatgagcttaaagaagaacgtgatggt
gtaaagcacctgctttaa

DBGET integrated database retrieval system