KEGG   Cycloclasticus sp. PY97N: CPC19_07895Help
Entry
CPC19_07895       CDS       T05126                                 

Definition
(GenBank) carbazole dioxygenase
  KO
K15751  carbazole 1,9a-dioxygenase [EC:1.14.12.22]
Organism
cyy  Cycloclasticus sp. PY97N
Pathway
cyy00621  Dioxin degradation
cyy01100  Metabolic pathways
cyy01120  Microbial metabolism in diverse environments
cyy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cyy00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    CPC19_07895
Enzymes [BR:cyy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.22  carbazole 1,9a-dioxygenase
     CPC19_07895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aromatic_hydrox Rieske
Motif
Other DBs
NCBI-ProteinID: ATI03396
LinkDB All DBs
Position
complement(1610054..1611226)
Genome map
AA seq 390 aa AA seqDB search
MDQSERILVNEEVVKKNKLWPNFIKAKLGFRNHWYPVMFGKEIEEGKPVKAMLCGENLLL
NRIDGKVYAIKDRCLHRGVAFSKKPECYTKETITCWYHAWTYRWDDGSLCDIMTDPKSDM
IGKHRLKTYTAQEAKGLVFIFLGDIEPTPLINDVPPGFLDEGRAIRGIKREVGSNWRIAA
ENGFDSTHVFIHKDSKLIPNNETVIPLGFATDREEEAKGTLWEVVNNEDGPKGVYDNIGQ
HAVPVVEGKVDGETVLRPVIGGDKRIANQISIWMPGALKVDPFPDPSLIQFEWYVPRDEN
SHWYIQTLGKEVANEAEEQEFEKDFNEKWEDWGLRGFNDDDIWAREAMEEFYKDDWGWIK
EQLFEPDGNIVAWRQLASEANRGVQTLEDL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaagtgaaagaattttagtcaacgaagaggtcgtgaaaaagaacaagttatgg
ccgaactttattaaggccaagctggggtttagaaaccattggtaccccgtcatgttcggt
aaagaaatagaagagggcaagcctgttaaggcgatgttatgtggtgaaaacctattactc
aaccgaattgatggaaaagtttatgccatcaaagataggtgtttacaccgaggtgttgcc
ttttctaaaaagcctgagtgttatacaaaagagaccattacctgttggtatcatgcttgg
acgtatcgatgggacgatggctcgttatgcgacattatgacggaccctaaaagcgatatg
attggtaagcatcgtcttaaaacgtataccgcgcaagaagcaaaagggcttgtatttatt
tttctcggcgatattgaacctacccctctgattaatgacgtaccacctgggtttttagat
gaagggcgtgcgattagaggcattaaacgagaagttgggtcaaactggagaatcgctgct
gaaaatggttttgattcaacacatgtttttattcataaagacagtaagttaataccaaac
aatgagaccgttattccattagggtttgcgacagatcgtgaagaagaagcaaaaggcacc
ttatgggaagtagttaataacgaagacggacctaagggtgtttacgataatatcggccag
catgcggttcccgtcgttgagggtaaagtagatggtgaaacagttcttcgtccggttatt
ggtggtgataaacgcatagccaaccaaatctcaatatggatgccaggcgcccttaaagta
gacccctttccagacccttcattgattcaatttgaatggtatgtgccaagagatgaaaac
tcacattggtatattcaaacgcttggtaaagaagtggctaatgaagctgaagagcaagag
tttgaaaaagattttaatgaaaagtgggaagactgggggctacgtggctttaatgatgat
gatatttgggcccgtgaagcgatggaagagttttacaaggatgactggggttggattaaa
gaacagttatttgagccagatggaaatatagtcgcgtggagacagttagccagtgaagca
aatcgcggtgtccaaacactagaagatttataa

DBGET integrated database retrieval system