KEGG   Cycloclasticus sp. PY97N: CPC19_07925Help
Entry
CPC19_07925       CDS       T05126                                 

Definition
(GenBank) AcrB/AcrD/AcrF family protein
  KO
K18303  multidrug efflux pump
Organism
cyy  Cycloclasticus sp. PY97N
Brite
KEGG Orthology (KO) [BR:cyy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cyy02000]
    CPC19_07925
   01504 Antimicrobial resistance genes [BR:cyy01504]
    CPC19_07925
Transporters [BR:cyy02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   CPC19_07925
Antimicrobial resistance genes [BR:cyy01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexJK-OprM [MD:M00642]
    CPC19_07925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran MMPL SecD_SecF
Motif
Other DBs
NCBI-ProteinID: ATI03401
LinkDB All DBs
Position
complement(1616313..1619399)
Genome map
AA seq 1028 aa AA seqDB search
MSDKERINLARWGIKHSQVLIYFMVVILVAGTFAFFKLGQRDLPVFAIKTIVVNVKWPGA
SAEEMSQFVTDPIETKLLEVPWLREVSSFSKPGEAWLIVNIEDFMPNAAIEMKDRAYDIR
KKINDIQHRLPEGVQGPFINDEFGDIFSMVYSFNSDDYSFADLKDYAEKARNALVRIESV
EKAILYSVQNEKIFVEMDDKRMSALGLDPLQIGMLLQQHNKVQTSGRIEGKQSYYRLSLN
DRFQSIDDIKKLPIKLQDNSVIYLENIATISRGYDDPPVFRMRVNGNPSIGLGITMRKGY
QLLTLSDEVKATMAEFTEQLPAGVEVVLVSDQPKSVQAQINRFLLKLLIAVFIVLVVCYF
SLGFRTGFIVALAIPVVLGLVFVMMSILGIPLTRTSLGALVIALGLLVDDAMIVVELVHV
KLEQGWDRLKAATYAYTATSKPMLSGTLIAAVGFLPVYIVDAAPNEILGNLFVVIGVALI
ASWIVAVLLTPYLSFKLLKVEHQGKQHIQTANVDNSAMYQSDFYNRFRRLIAWCMCHNKT
VLGVTALAFVLTIFGMQHVKMEFFPGNDRPEALVDVWFPEGTSYHQMERQIADVERLLDA
QDNIENYLTYIGGDSLRVQNDMYIEQPNANYSKIIVIAKNLEARAQIKTLLSDYFATHQP
NVRTRVYNLVYGLPFNYPVQYLITGNDAEKLADISEQLKDILRNNPQTRDVHDNRREKRV
VVDIKLDLPRVAASGTDPAQLSKTLGVMLNGLPVTQYREGNDHIDVVLRNESENRYNLDR
INYLQVPLGNGTTVALSELADISLKFEEGVIWRYNGYRSVIVQSLLEEGVLNFDVVKALK
PQIDELRDSLPSGYRVEVFGEVDISREVDTQLAKTMPFMLIAILTLLMFELNSIKKMFLV
LMTVPLGLIGVVFILLVLDLSFGLVARLGLLALVGIIIRNSIILMDQIDQDLAAGSSPWN
AVLESTVRRARPIILTALAAIFAMIPLITDYFWGPMAITMMSGLLVATLLTLLVFPTMYV
AFFKVKSQ
NT seq 3087 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataaagagcgcataaacctcgcacgatggggaataaagcactcacaggtgctg
atctattttatggttgttattttggtggccggaacgtttgcctttttcaagctagggcag
cgtgatttacccgtttttgcaattaaaactattgtggttaatgtgaaatggcccggggcg
tcggcagaagaaatgtcgcaattcgtgacagaccccattgaaacaaaattactagaagtg
ccttggcttcgcgaagtcagctcgtttagtaaaccgggtgaggcgtggttaatcgttaat
attgaagattttatgccaaatgccgcgatagagatgaaggatcgtgcgtatgacatacga
aaaaaaatcaatgatattcaacaccgattgcctgaaggtgttcaaggtccttttattaat
gatgagtttggcgatattttttcaatggtgtacagcttcaatagtgacgactactcattt
gcggatttgaaagattatgctgagaaagcgcgaaatgctttggtgcgtattgagtcagtg
gaaaaagctattttatacagcgtacaaaatgaaaaaatatttgtagagatggatgataag
cgtatgtcggcgctgggtttagatcctttgcaaattggtatgttgttgcaacaacataat
aaggtgcaaaccagtggccgaatagaaggtaagcagtcctattataggcttagccttaat
gatcgttttcaatccattgacgatataaaaaaactgcctattaagctacaggataatagc
gttatatatcttgaaaatatcgccactattagccgaggttacgacgatccgcctgtattc
aggatgcgtgttaatggtaacccgtctattgggctaggtattacgatgcgtaaaggctat
caattactgaccttgtcagatgaggttaaggccaccatggcagagtttacagaacagtta
cccgctggtgtggaggtcgttttggtgagcgatcagcctaaatctgtgcaagcacaaatc
aatcggtttttgcttaaattattaatagctgtttttattgtattggtggtttgctatttc
tcacttgggtttcgtaccggctttatcgtagcgctagccattcctgtggttttgggtttg
gtatttgtcatgatgtctatattaggaatcccccttacccgtacctctttgggtgcctta
gtcattgcacttggcttgttagtagatgatgcgatgatcgtggtggaattagttcatgta
aaactcgagcaaggttgggataggttaaaagctgctacctatgcatatactgcgacatcg
aaaccgatgttaagtggtaccttaattgcggccgtaggttttttaccagtttatattgtc
gatgcagcaccgaatgagatattgggtaatctttttgtagtgattggtgtggcgttaatt
gcctcttggatagtggctgtattgttaaccccttatttgtcttttaaattgctaaaggtt
gaacaccagggtaagcagcacatacaaacggctaatgtcgacaattcggctatgtatcag
agtgatttttataatcggtttcgccgcttaatcgcttggtgtatgtgtcataacaaaacg
gtactaggggtcacggcactcgcattcgttttgaccatatttggaatgcagcatgtaaaa
atggagttttttccaggcaatgatcgccctgaggcactggtcgatgtctggttcccggag
gggactagctaccatcaaatggagcgtcagatcgccgatgttgaacggttgctagacgca
caagataatattgaaaattaccttacttatatcggcggggattctttgcgtgtacagaat
gatatgtacatagagcaacctaatgcgaactacagcaaaattattgtgattgcaaagaac
ctagaggcacgtgcacaaataaaaactttgttaagcgactattttgcaacacatcaaccc
aatgtgcgaacccgtgtgtataaccttgtatatggtttaccgttcaactaccccgttcaa
tatttaatcactggaaatgatgctgaaaaattggctgatatttctgagcaattaaaagac
atactcagaaataatccacaaacaagagatgtgcatgataatcgtcgagaaaaacgggtg
gtggtagatattaagcttgacttgccccgtgtggcagctagtgggactgatccggctcag
ttgagcaaaacactcggtgttatgcttaatggcttaccggtgactcaatatcgcgagggt
aatgaccatattgatgttgtgcttcgtaatgaatcggagaatcgttataacctagatcga
attaattatttacaagtgcccttaggcaacggaacaaccgttgcgttgtctgagctggca
gatatcagtttgaaatttgaagaaggtgttatctggcgctataacggatatcgttcggtg
attgtgcagtcattattggaagagggcgtgttgaattttgatgtggttaaagcgttaaaa
ccacagatagatgagttacgtgattcattacctagtggttatcgggttgaagtgtttgga
gaagtggatatctccagagaagttgatacacaattagcgaaaacaatgccttttatgttg
attgcgatacttaccttattaatgtttgagctaaatagtataaaaaaaatgttcttagtt
ttaatgacggtaccattaggactgattggtgttgtctttattttattagtattggacttg
tcatttggtctagtagcacggcttggcttactggccttggtgggtattattattcgaaat
tcgattattttaatggatcaaattgatcaagatttagcggcgggttcatcaccttggaat
gcggtattggagtcaactgtacgacgtgctcggccgattattttgacagccttggcagct
attttcgcgatgataccgttgattacagattatttttggggtccaatggcgatcactatg
atgtcgggactgttagttgcgaccttgttaacattgctggtatttccaacgatgtacgtg
gcgttttttaaggttaaaagtcagtaa

DBGET integrated database retrieval system