KEGG   Cycloclasticus sp. PY97N: CPC19_10325Help
Entry
CPC19_10325       CDS       T05126                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
cyy  Cycloclasticus sp. PY97N
Pathway
cyy03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:cyy00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CPC19_10325
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cyy03400]
    CPC19_10325
Enzymes [BR:cyy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     CPC19_10325
DNA repair and recombination proteins [BR:cyy03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     CPC19_10325
 Prokaryotic type
     CPC19_10325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ATI03842
LinkDB All DBs
Position
2141478..2142173
Genome map
AA seq 231 aa AA seqDB search
MALTNAPSWKPFLDDELNQPYMLVLKEFLRIEKNDGKTIYPHSANWFHALEACPLNDVKV
VILGQDPYHQPHQAHGLCFSVQPDVKIPPSLLNIYKELHADLGIPYALHGCLESWAKQGV
LLLNSVLTVEYDKPNAHQGKGWETFTDKIIHTVAEQNEHVVFLLWGNYAQKKGAFIDEQQ
HLVLKAPHPSPLSAHRGFLGCRHFSQTNHYLQQHNIPPIHWELPKLAAPVS
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggcacttactaatgcacccagctggaaaccttttttagatgacgagctaaaccaaccg
tatatgctagtccttaaggagtttctgcgcatagaaaaaaacgatggcaaaactatctac
cctcattctgccaactggtttcacgcattggaggcctgccctttaaacgacgtaaaagtt
gttatcttgggccaagacccctatcatcagccgcaccaagcacacggtctgtgcttttcg
gttcagccagatgtcaaaataccaccatcactgttaaatatttataaggaattacacgcc
gacttaggtattccttatgccttacatggctgtttagagagctgggcaaaacaaggtgtt
ttattactaaatagtgtcctcaccgttgagtacgacaagcctaacgctcaccaaggaaaa
ggctgggaaacatttacagacaaaatcattcatacggttgctgaacaaaacgaacacgtt
gtgtttctactttggggcaattacgcacaaaaaaaaggggctttcatcgatgagcagcag
caccttgttttaaaagccccacacccgtcaccattatcagcccaccgtggttttttaggt
tgtcggcactttagtcaaaccaaccattacctgcaacaacataatatcccccctattcat
tgggaattgccaaaactagcggcacctgttagttaa

DBGET integrated database retrieval system