KEGG   Cycloclasticus zancles: CYCME_0309Help
Entry
CYCME_0309        CDS       T02780                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cza  Cycloclasticus zancles
Pathway
cza00030  Pentose phosphate pathway
cza01100  Metabolic pathways
cza01120  Microbial metabolism in diverse environments
cza01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cza00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CYCME_0309
Enzymes [BR:cza01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CYCME_0309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AGS38651
UniProt: S5T4C5
LinkDB All DBs
Position
complement(304853..306712)
Genome map
AA seq 619 aa AA seqDB search
MSWTKKVLRINLTNRTSSEEPLNMEWAELYLGQRGLATKYLTEEVDPTVEPLAPENKLYM
VTGPLTGTMASTGGRYSCVTKSPLTNALACSNSGGFFGNEMKCAGWDMIILEGKASSPVY
ISIVDEKCEILPADEIWGKSVWEADEWLHNKHQDPQLRIAAIGLPGEKGNLYSAIVNDLH
RAAGRSGVGAVMGSKNVKAVTLRGSKGVGNIKDPKRFFEATNKAKKIIADSEMTQGLSAL
GTNVMMNHMNEVGALPARNWQDSTFDNAPKLSSEAMAVPRESDGKPNLTRNAGCFACTIS
CGRISTIDPEHFSIKNRDDIHKHFKGNSGGNEYEAAWALGCDTGVDDLDAVTYANFVCNE
QALDPISAGATIAAAMELYELGILTKEDTGGIEMNFGNAEAMVECIELIAKHEGFGQELA
QSSLRFCEKYGRPDLAIVVKGQEFPAYDARAVKGMGLGYATSNRGACHVRGYTNGSETAG
IPFKTDPLAYEGKAELLMAFQDTTSVFDSAGICTFSSFAQGIEEVAEQIDAACEGDWTAE
RLGQLGERVWNLEREFNNNAGFTAADDTLPPRLLSEPVKAGPAKGEVCELDRMLPEYYEV
RGWNQDGTLKEATKQRLSL
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgagctggactaaaaaagtattacgcataaatctaacaaacaggacatcttctgaagaa
cctctcaatatggagtgggcagaactttatctaggccagagagggctagcgacaaagtac
cttacagaagaagtggacccaaccgtcgagcctctagcgccagaaaacaagctgtatatg
gtaacaggcccactaacaggcaccatggcttcaacgggtggtcgttactcttgtgtcact
aaaagccccttaaccaatgctctggcttgctcaaattcaggtggtttttttggcaacgaa
atgaaatgtgctggctgggatatgattatcctagaaggcaaagcaagctccccagtttat
atcagcatcgttgatgaaaaatgcgagatcctgccggcggatgaaatttggggcaaatct
gtttgggaagccgatgaatggcttcataataaacaccaagaccctcaactaagaatcgct
gctattggcctacctggtgaaaagggcaacctatattctgctatcgttaatgacttacat
cgtgctgctgggcgttccggcgtaggcgctgttatgggttcaaaaaatgtcaaagcggtg
acccttagaggcagcaaaggtgttggcaatataaaagatccaaaacgtttcttcgaagcc
accaacaaagctaaaaaaattatcgctgacagtgaaatgactcaaggtctcagcgcctta
ggtaccaatgtcatgatgaaccatatgaacgaagtgggtgctttaccggctagaaactgg
caagacagcacctttgacaatgcacctaaactgtcaagtgaagcgatggctgtgccaaga
gaaagtgacggcaagccaaatttaacacgaaatgccggctgctttgcctgcactatatct
tgcggacgcatctcaacaatcgacccagagcatttcagcattaaaaaccgtgatgacatc
cacaagcactttaaaggcaactctggtggtaacgaatatgaagcagcatgggcattgggt
tgcgataccggcgttgatgatttagacgccgtgacctatgctaactttgtctgtaatgag
caagctcttgaccccatctcagcaggcgccactattgctgcagccatggaattatatgag
ctaggcatactcacaaaagaagataccggcggcattgaaatgaactttggcaatgctgaa
gcgatggtggaatgtattgaactgattgcaaaacatgaaggctttggacaagaactcgct
caaagctcacttcgtttttgtgaaaaatacggccgtccagacctcgctattgttgttaaa
gggcaagagtttccagcctatgatgctcgcgccgtaaaaggcatgggccttggatatgcc
acatcaaaccgcggcgcctgtcacgtacgtggttacactaacggctcagaaacagctggg
atacctttcaaaacagatccattagcctatgaaggaaaagcagaactactgatggcattc
caagatacaaccagtgtgtttgattctgccggcatctgcaccttctcatccttcgcacaa
ggcattgaagaagtggcagaacaaattgatgctgcctgcgaaggcgactggacagctgaa
agactcggccaattaggcgagcgcgtttggaaccttgagcgtgagttcaacaacaatgct
ggtttcacagctgccgatgacacgcttccacctcgcttattaagtgagcctgtcaaagca
ggccctgcaaaaggtgaagtttgtgagctagatagaatgttgcccgaatactacgaagtt
cgtggttggaatcaagacggcacacttaaagaagcaacaaaacaacgcctaagtttgtaa

DBGET integrated database retrieval system